mRNA_M-pyrifera_M_contig99861.22960.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A661NVI3_9DELT (Peptidase S1 domain-containing protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A661NVI3_9DELT) HSP 1 Score: 75.1 bits (183), Expect = 2.260e-13 Identity = 37/72 (51.39%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 1 PCTDDFCDTGIGCFSVP-ASGSSCTTSSICMLRDGFCVVGECVGE-PINCDDLNPCTEDSCSPSLGCQHRQL 210 PCT+D C+ GC P A G+SC +C + C G CV + P +CDD NPCTEDSC P GCQHRQL Sbjct: 343 PCTEDVCNAASGCIFRPVADGTSCDDGDLCNGEE-ICQQGSCVMQAPADCDDGNPCTEDSCEPGSGCQHRQL 413
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A7V6B7C3_9DELT (Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A7V6B7C3_9DELT) HSP 1 Score: 73.6 bits (179), Expect = 7.000e-13 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 1 Query: 1 PCTDDFCDTGIGCFSVPASGSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQH 201 PCT D CD GC +VP G C+ ++ C D C G CVG+P+NCDD N CT D+C + GC H Sbjct: 156 PCTQDSCDPQHGCINVPLDGVLCSANNACTQND-VCKAGVCVGQPVNCDDNNICTTDTCDRTKGCLH 221
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A2E4FCX5_9DELT (Uncharacterized protein (Fragment) n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E4FCX5_9DELT) HSP 1 Score: 68.2 bits (165), Expect = 6.200e-11 Identity = 33/68 (48.53%), Postives = 40/68 (58.82%), Query Frame = 1 Query: 1 PCTDDFCDTGIGCFSVPASGSSCTTSSICMLRDGFCVVGECV-GEPINCDDLNPCTEDSCSPSLGCQH 201 PCT+D C GC +P +G SC+ +C L D CV G C G +CDD NPCT+DSC P CQH Sbjct: 402 PCTEDLCLPDEGCSHLPTTGPSCSDGDLCTLGDS-CVAGVCSSGVDQDCDDSNPCTDDSCGPDGLCQH 468
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A3M1D3V6_9DELT (Peptidase S1 domain-containing protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A3M1D3V6_9DELT) HSP 1 Score: 65.1 bits (157), Expect = 7.330e-10 Identity = 31/72 (43.06%), Postives = 43/72 (59.72%), Query Frame = 1 Query: 1 PCTDDFCDTGIGCFSVPAS-GSSCTTSSICMLRDGFCVVGECVG-EPINCDDLNPCTEDSCSPSLGCQHRQL 210 PCT D C+ GCF G+SC+ ++ C G+CV EP++CDD N CTED+C P++GC H +L Sbjct: 411 PCTSDECNPATGCFHRSVEDGTSCSXXXXXXGQE-VCQAGQCVSSEPLDCDDANACTEDTCDPAVGCSHTEL 481
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A3A8JYV2_9DELT (Uncharacterized protein n=2 Tax=Corallococcus TaxID=83461 RepID=A0A3A8JYV2_9DELT) HSP 1 Score: 63.9 bits (154), Expect = 1.930e-9 Identity = 33/67 (49.25%), Postives = 40/67 (59.70%), Query Frame = 1 Query: 37 CFSVP-ASGSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQHRQLDC-EPQAP 231 C P G++C SS C +DG C G CVG+P CDD NPCT DSCSP+ GC + C EP+ P Sbjct: 149 CIETPQGDGAACIPSSRCQ-QDGHCQAGVCVGQPRTCDDDNPCTVDSCSPTQGCVRADVVCPEPRDP 214
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A7Y5GYB1_9DELT (Uncharacterized protein n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A7Y5GYB1_9DELT) HSP 1 Score: 63.5 bits (153), Expect = 2.760e-9 Identity = 33/67 (49.25%), Postives = 39/67 (58.21%), Query Frame = 1 Query: 4 CTDDFCDTGIGCFSVPASGSSCTTSSICMLRDGFCVVGECVG-EPINCDDLNPCTEDSCSPSLGCQH 201 CT D C +GC G+ C +S+C D C G CVG PI+CDD +PCT DSC P LGCQH Sbjct: 1263 CTLDKCVANVGCQYTSLPGT-CNDNSVCTQVDA-CSAGVCVGASPIDCDDSDPCTTDSCDPILGCQH 1327
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: UPI001A8FF724 (hypothetical protein n=1 Tax=Corallococcus macrosporus TaxID=35 RepID=UPI001A8FF724) HSP 1 Score: 62.8 bits (151), Expect = 4.890e-9 Identity = 34/73 (46.58%), Postives = 40/73 (54.79%), Query Frame = 1 Query: 4 CTDDFCDTGIG-CFSVP-ASGSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQHRQLDC 216 C D D G C P A G+SC S C +G C G CVG+P CDD NPCT DSCSP+ GC ++ C Sbjct: 138 CRDSRFDLASGQCIESPQADGASCIPGSRCQ-ENGRCQAGVCVGQPRTCDDDNPCTVDSCSPTQGCVTERVTC 209
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: UPI001CBE2BBD (hypothetical protein n=1 Tax=Corallococcus sp. EGB TaxID=1521117 RepID=UPI001CBE2BBD) HSP 1 Score: 62.8 bits (151), Expect = 4.920e-9 Identity = 34/73 (46.58%), Postives = 40/73 (54.79%), Query Frame = 1 Query: 4 CTDDFCDTGIG-CFSVP-ASGSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQHRQLDC 216 C D D G C P A G+SC SS C +G C G C+G+P CDD NPCT DSCSP+ GC + C Sbjct: 138 CHDSRFDVDSGQCIETPQADGASCIPSSRCQ-ENGRCQAGACLGQPRTCDDDNPCTVDSCSPTQGCVTEAVAC 209
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A3A8PEW0_9DELT (Uncharacterized protein (Fragment) n=1 Tax=Corallococcus llansteffanensis TaxID=2316731 RepID=A0A3A8PEW0_9DELT) HSP 1 Score: 62.4 bits (150), Expect = 6.090e-9 Identity = 29/53 (54.72%), Postives = 34/53 (64.15%), Query Frame = 1 Query: 58 GSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQHRQLDC 216 G+SC SS C +DG C G CVG+P CDD NPCT DSCSP+ GC + C Sbjct: 157 GASCIPSSRCQ-QDGRCQAGVCVGQPRTCDDDNPCTVDSCSPTQGCVKADVVC 208
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Match: A0A554GCQ8_9DELT (Uncharacterized protein n=2 Tax=Corallococcus TaxID=83461 RepID=A0A554GCQ8_9DELT) HSP 1 Score: 62.0 bits (149), Expect = 9.080e-9 Identity = 31/67 (46.27%), Postives = 40/67 (59.70%), Query Frame = 1 Query: 22 DTGIGCFSVPASGSSCTTSSICMLRDGFCVVGECVGEPINCDDLNPCTEDSCSPSLGCQHRQLDCEP 222 ++G+ S A G+SC SS C +G C G CVG P C+D NPCT DSCSP+ GC ++ C P Sbjct: 145 ESGLCIESPQADGASCIPSSRCQ-ENGTCQAGVCVGRPRTCNDDNPCTVDSCSPTQGCVTEKVVCPP 210 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99861.22960.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99861.22960.1 >prot_M-pyrifera_M_contig99861.22960.1 ID=prot_M-pyrifera_M_contig99861.22960.1|Name=mRNA_M-pyrifera_M_contig99861.22960.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=119bp PCTDDFCDTGIGCFSVPASGSSCTTSSICMLRDGFCVVGECVGEPINCDDback to top mRNA from alignment at M-pyrifera_M_contig99861:2..358+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99861.22960.1 ID=mRNA_M-pyrifera_M_contig99861.22960.1|Name=mRNA_M-pyrifera_M_contig99861.22960.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=357bp|location=Sequence derived from alignment at M-pyrifera_M_contig99861:2..358+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99861:2..358+ >mRNA_M-pyrifera_M_contig99861.22960.1 ID=mRNA_M-pyrifera_M_contig99861.22960.1|Name=mRNA_M-pyrifera_M_contig99861.22960.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=714bp|location=Sequence derived from alignment at M-pyrifera_M_contig99861:2..358+ (Macrocystis pyrifera P11B4 male)back to top |