mRNA_M-pyrifera_M_contig99856.22958.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Match: D4S797_9FIRM (Exodeoxyribonuclease III n=20 Tax=Selenomonadaceae TaxID=1843491 RepID=D4S797_9FIRM) HSP 1 Score: 54.3 bits (129), Expect = 3.790e-6 Identity = 28/54 (51.85%), Postives = 34/54 (62.96%), Query Frame = 1 Query: 1 FVDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLLLIDAALSCRCGALLQVH 162 FVD FRA +P R+GAYT+W ARETN G RID L+ A L R A ++H Sbjct: 182 FVDTFRALYPDRTGAYTWWSYLRHARETNAGWRIDYFLVSAELRDRIAAA-EIH 234
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Match: K9CUQ0_9FIRM (Exodeoxyribonuclease III (Xth) n=1 Tax=Selenomonas sp. F0473 TaxID=999423 RepID=K9CUQ0_9FIRM) HSP 1 Score: 52.8 bits (125), Expect = 1.360e-5 Identity = 28/55 (50.91%), Postives = 33/55 (60.00%), Query Frame = 1 Query: 1 FVDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLLLIDAALSCRCGALLQVHA 165 FVD FRA +P R GAYT+W ARETN G RID L+ L R A ++HA Sbjct: 182 FVDTFRALYPDRRGAYTWWSYLRHARETNAGWRIDYFLVSEELRGRVAAA-EIHA 235
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Match: A0A0G1FA55_9BACT (Exodeoxyribonuclease III n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1FA55_9BACT) HSP 1 Score: 52.0 bits (123), Expect = 2.670e-5 Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 4 VDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLLLI 117 +D +R +PH++GAYT+WD TAARE N G R+D L + Sbjct: 188 IDTYRHFYPHKTGAYTYWDMKTAARERNVGWRLDYLFV 225
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Match: A0A0G1AZ23_9BACT (Exodeoxyribonuclease III n=2 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G1AZ23_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 7.650e-5 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 4 VDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLL 111 +D +R +PH++GAYT+WD TAARE N G R+D L Sbjct: 225 IDTYRHFYPHKTGAYTYWDMKTAARERNVGWRLDYL 260
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Match: UPI000D7303AA (LOW QUALITY PROTEIN: DNA-(apurinic or apyrimidinic site) lyase 2-like n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D7303AA) HSP 1 Score: 50.8 bits (120), Expect = 9.350e-5 Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 1 Query: 1 FVDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLLLIDAALS 132 FVDAFR P ++ AYT W TTT+AR+TN G R+D + +D L+ Sbjct: 244 FVDAFRFFHPDQTEAYTNWSTTTSARQTNYGKRLDYIYVDERLA 287 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99856.22958.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99856.22958.1 >prot_M-pyrifera_M_contig99856.22958.1 ID=prot_M-pyrifera_M_contig99856.22958.1|Name=mRNA_M-pyrifera_M_contig99856.22958.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=127bp FVDAFRACFPHRSGAYTFWDTTTAARETNCGSRIDLLLIDAALSCRCGALback to top mRNA from alignment at M-pyrifera_M_contig99856:142..522- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99856.22958.1 ID=mRNA_M-pyrifera_M_contig99856.22958.1|Name=mRNA_M-pyrifera_M_contig99856.22958.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=381bp|location=Sequence derived from alignment at M-pyrifera_M_contig99856:142..522- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99856:142..522- >mRNA_M-pyrifera_M_contig99856.22958.1 ID=mRNA_M-pyrifera_M_contig99856.22958.1|Name=mRNA_M-pyrifera_M_contig99856.22958.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=762bp|location=Sequence derived from alignment at M-pyrifera_M_contig99856:142..522- (Macrocystis pyrifera P11B4 male)back to top |