mRNA_M-pyrifera_M_contig99741.22923.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99741.22923.1 vs. uniprot
Match: A0A833SAT9_9HYME (Uncharacterized protein n=1 Tax=Frieseomelitta varia TaxID=561572 RepID=A0A833SAT9_9HYME) HSP 1 Score: 52.0 bits (123), Expect = 2.070e-5 Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 1 LMYCGCSDGRIVVYSGSEGEEVLSFHGHGKAVTGLEISDSC--LWSCSEDGTVCTWNI 168 L+Y GC+D +I V+S +G+ V + GH + + GL + DS L SCSEDGTV W++ Sbjct: 134 LLYAGCNDSKIYVFSLEDGKLVTTLEGHTRFIHGLSLLDSGTQLASCSEDGTVRLWDL 191 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99741.22923.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99741.22923.1 >prot_M-pyrifera_M_contig99741.22923.1 ID=prot_M-pyrifera_M_contig99741.22923.1|Name=mRNA_M-pyrifera_M_contig99741.22923.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=111bp MYCGCSDGRIVVYSGSEGEEVLSFHGHGKAVTGLEISDSCLWSCSEDGTVback to top mRNA from alignment at M-pyrifera_M_contig99741:155..490+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99741.22923.1 ID=mRNA_M-pyrifera_M_contig99741.22923.1|Name=mRNA_M-pyrifera_M_contig99741.22923.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig99741:155..490+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99741:155..490+ >mRNA_M-pyrifera_M_contig99741.22923.1 ID=mRNA_M-pyrifera_M_contig99741.22923.1|Name=mRNA_M-pyrifera_M_contig99741.22923.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=666bp|location=Sequence derived from alignment at M-pyrifera_M_contig99741:155..490+ (Macrocystis pyrifera P11B4 male)back to top |