mRNA_M-pyrifera_M_contig9973.22919.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9973.22919.1 vs. uniprot
Match: D7G709_ECTSI (Heat shock protein 70 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G709_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 1.210e-14 Identity = 40/51 (78.43%), Postives = 45/51 (88.24%), Query Frame = 1 Query: 1 VEAEMEAEAKAFELERKNNPEENEDHDTRKLPKPERMRLVAKNKEARSQTY 153 VEAEMEAEAKAFE E+KNNPEE +DHDTRKLPKPERMRLV KNKE ++ + Sbjct: 544 VEAEMEAEAKAFEEEKKNNPEEGDDHDTRKLPKPERMRLVMKNKEEGTELF 594 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9973.22919.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig9973.22919.1 >prot_M-pyrifera_M_contig9973.22919.1 ID=prot_M-pyrifera_M_contig9973.22919.1|Name=mRNA_M-pyrifera_M_contig9973.22919.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bp MEAEAKAFELERKNNPEENEDHDTRKLPKPERMRLVAKNKEARSQTYMSIback to top mRNA from alignment at M-pyrifera_M_contig9973:7652..7828+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig9973.22919.1 ID=mRNA_M-pyrifera_M_contig9973.22919.1|Name=mRNA_M-pyrifera_M_contig9973.22919.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=177bp|location=Sequence derived from alignment at M-pyrifera_M_contig9973:7652..7828+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig9973:7652..7828+ >mRNA_M-pyrifera_M_contig9973.22919.1 ID=mRNA_M-pyrifera_M_contig9973.22919.1|Name=mRNA_M-pyrifera_M_contig9973.22919.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig9973:7652..7828+ (Macrocystis pyrifera P11B4 male)back to top |