mRNA_M-pyrifera_M_contig99396.22868.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99396.22868.1 vs. uniprot
Match: A0A2I0AFE1_9ASPA (Protein arginine N-methyltransferase 2 n=1 Tax=Apostasia shenzhenica TaxID=1088818 RepID=A0A2I0AFE1_9ASPA) HSP 1 Score: 55.5 bits (132), Expect = 2.380e-7 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 13 EEFCAAARAGDCARLTRLLERGADVNCRTQDGESPLLWASNGGFVAAVRLLLEAGA 180 E CAAA AGDCARL LL GAD + DG++PL+ A+ GG AVR LL+ GA Sbjct: 7 EILCAAAVAGDCARLRELLSSGADPSFFDSDGKTPLMHAAAGGHADAVRCLLDDGA 62
BLAST of mRNA_M-pyrifera_M_contig99396.22868.1 vs. uniprot
Match: A0A1V9ZSZ9_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9ZSZ9_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 5.420e-6 Identity = 30/60 (50.00%), Postives = 35/60 (58.33%), Query Frame = 1 Query: 13 EEFCAAARAGDCARLTRLLERGADVNCRTQDGESPLLWASNGGFVAAVRLLLEAGANVGA 192 + CAAARAGD ARL LLE GA V G +PL A GG VA + L+ GA+V A Sbjct: 3 DAVCAAARAGDMARLHELLEEGASVRNMRWSGVTPLHRACEGGHVAVIETLVSHGADVNA 62
BLAST of mRNA_M-pyrifera_M_contig99396.22868.1 vs. uniprot
Match: UPI001EE50F8E (palmitoyltransferase AKR1-like isoform X1 n=11 Tax=Haliotis rubra TaxID=36100 RepID=UPI001EE50F8E) HSP 1 Score: 49.7 bits (117), Expect = 2.730e-5 Identity = 26/59 (44.07%), Postives = 39/59 (66.10%), Query Frame = 1 Query: 13 EEFCAAARAGDCARLTRLLERG-ADVNCRTQDGESPLLWASNGGFVAAVRLLLEAGANV 186 ++ A R G+ A + R+L+ G ADVNCR+ DG +P++WA+ GG V LL+ GA+V Sbjct: 260 DDLHVACREGNLAEVKRILDTGRADVNCRSVDGMTPVMWAALGGHRDVVELLVSRGADV 318
BLAST of mRNA_M-pyrifera_M_contig99396.22868.1 vs. uniprot
Match: UPI0016632183 (ankyrin repeat domain-containing protein n=2 Tax=Tsuneonella deserti TaxID=2035528 RepID=UPI0016632183) HSP 1 Score: 49.3 bits (116), Expect = 3.680e-5 Identity = 29/66 (43.94%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 1 DVSAEEFCAAARAGDCARLTRLLERGADVNCRTQDGESPLLWASNGGFVAAVRLLLEAGANVGAAH 198 DV + AAAR + ++ LL +GADVN G +PL+ A+ G + AV+LL+ AGA+ GAAH Sbjct: 49 DVVEMQLSAAARECRPSEVSALLAKGADVNSVNSGGYTPLMLAAGEGCIEAVKLLIAAGADTGAAH 114 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99396.22868.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99396.22868.1 >prot_M-pyrifera_M_contig99396.22868.1 ID=prot_M-pyrifera_M_contig99396.22868.1|Name=mRNA_M-pyrifera_M_contig99396.22868.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=66bp DVSAEEFCAAARAGDCARLTRLLERGADVNCRTQDGESPLLWASNGGFVAback to top mRNA from alignment at M-pyrifera_M_contig99396:10..207- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99396.22868.1 ID=mRNA_M-pyrifera_M_contig99396.22868.1|Name=mRNA_M-pyrifera_M_contig99396.22868.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=198bp|location=Sequence derived from alignment at M-pyrifera_M_contig99396:10..207- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99396:10..207- >mRNA_M-pyrifera_M_contig99396.22868.1 ID=mRNA_M-pyrifera_M_contig99396.22868.1|Name=mRNA_M-pyrifera_M_contig99396.22868.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=396bp|location=Sequence derived from alignment at M-pyrifera_M_contig99396:10..207- (Macrocystis pyrifera P11B4 male)back to top |