mRNA_M-pyrifera_M_contig99272.22840.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99272.22840.1 vs. uniprot
Match: A0A2E0LJE6_9GAMM (Uncharacterized protein n=1 Tax=Porticoccaceae bacterium TaxID=2026782 RepID=A0A2E0LJE6_9GAMM) HSP 1 Score: 59.3 bits (142), Expect = 6.230e-9 Identity = 34/81 (41.98%), Postives = 45/81 (55.56%), Query Frame = 1 Query: 7 IFDAQGFVDDCLAAVATDDPIAGVSRVMEKAISDPAALLAGVD--ASGDGVVSLCMSDTLTALQVSTEPQIESPIHNHLTW 243 +FD Q F++DC AAV +DDP V ++ME A +D A+ + A V L + LT L+V T SPIHNHL W Sbjct: 1 MFDLQAFIEDCKAAVRSDDPQGEVRQLMEAAFADREAVRGALADAAPPKDVAPLYADEHLTVLRVFTPANFISPIHNHLMW 81
BLAST of mRNA_M-pyrifera_M_contig99272.22840.1 vs. uniprot
Match: A0A7V9NQF5_9ACTN (Uncharacterized protein n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7V9NQF5_9ACTN) HSP 1 Score: 50.8 bits (120), Expect = 9.530e-6 Identity = 25/79 (31.65%), Postives = 46/79 (58.23%), Query Frame = 1 Query: 7 IFDAQGFVDDCLAAVATDDPIAGVSRVMEKAISDPAALLAGVDASGDGVVSLCMSDTLTALQVSTEPQIESPIHNHLTW 243 +FD +GFV C AA+A +P + +V+++A++D +A+ + G+ +L +D LT L V P+++ H+H W Sbjct: 1 MFDVEGFVAQCQAAIAEVEPRRAIRQVLDRALADRSAMADALKPEEGGLNTLHRADDLTVLHVVWAPKMKLLPHDHRMW 79
BLAST of mRNA_M-pyrifera_M_contig99272.22840.1 vs. uniprot
Match: A0A2E6X4I0_9PROT (Uncharacterized protein n=1 Tax=Magnetovibrio sp. TaxID=2024836 RepID=A0A2E6X4I0_9PROT) HSP 1 Score: 50.1 bits (118), Expect = 1.870e-5 Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 1 Query: 7 IFDAQGFVDDCLAAVATDDPIAGVSRVMEKAISDPAALLAGV-DASGDGVVSLCMSDTLTALQVSTEPQIESPIHNHLTW 243 +F + F++DC A+ D V ++++A+SDPAAL+ + + S GV L +S+ LT L + P++ HNH W Sbjct: 1 MFKIEPFIEDCKLAIRESDSHIAVKELVDRAVSDPAALMEALGEPSRGGVDQLYVSEGLTILNLVWAPRMTLRPHNHNMW 80 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99272.22840.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99272.22840.1 >prot_M-pyrifera_M_contig99272.22840.1 ID=prot_M-pyrifera_M_contig99272.22840.1|Name=mRNA_M-pyrifera_M_contig99272.22840.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=81bp MSIFDAQGFVDDCLAAVATDDPIAGVSRVMEKAISDPAALLAGVDASGDGback to top mRNA from alignment at M-pyrifera_M_contig99272:1..243- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99272.22840.1 ID=mRNA_M-pyrifera_M_contig99272.22840.1|Name=mRNA_M-pyrifera_M_contig99272.22840.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=243bp|location=Sequence derived from alignment at M-pyrifera_M_contig99272:1..243- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99272:1..243- >mRNA_M-pyrifera_M_contig99272.22840.1 ID=mRNA_M-pyrifera_M_contig99272.22840.1|Name=mRNA_M-pyrifera_M_contig99272.22840.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=486bp|location=Sequence derived from alignment at M-pyrifera_M_contig99272:1..243- (Macrocystis pyrifera P11B4 male)back to top |