mRNA_M-pyrifera_M_contig99249.22831.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: A0A6H5JHB7_9PHAE (C2H2-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JHB7_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 1.220e-9 Identity = 27/33 (81.82%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQ 99 +G+L+KNKDL KAFGT+NQLEAC+IILDKGEMQ Sbjct: 64 KGVLAKNKDLMKAFGTDNQLEACRIILDKGEMQ 96
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: A0A0B2VZK2_TOXCA (Ribosome maturation protein SBDS n=4 Tax=Ascaridoidea TaxID=33256 RepID=A0A0B2VZK2_TOXCA) HSP 1 Score: 47.4 bits (111), Expect = 4.720e-5 Identity = 19/33 (57.58%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQ 99 +G+++K ++L AFGTE+QLE CK+ILDKG++Q Sbjct: 64 KGLIAKREELNAAFGTEDQLEICKLILDKGDLQ 96
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: UPI0001CBA9C6 (ribosome maturation protein SBDS-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBA9C6) HSP 1 Score: 47.0 bits (110), Expect = 6.480e-5 Identity = 22/37 (59.46%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQARER 111 +G +SK +DLK+AFGTE+Q E CK+IL KGE Q E+ Sbjct: 62 KGQVSKKEDLKRAFGTEDQTEICKMILAKGEFQVSEK 98 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99249.22831.1 >prot_M-pyrifera_M_contig99249.22831.1 ID=prot_M-pyrifera_M_contig99249.22831.1|Name=mRNA_M-pyrifera_M_contig99249.22831.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=37bp QGILSKNKDLKKAFGTENQLEACKIILDKGEMQARERback to top mRNA from alignment at M-pyrifera_M_contig99249:171..281- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99249.22831.1 ID=mRNA_M-pyrifera_M_contig99249.22831.1|Name=mRNA_M-pyrifera_M_contig99249.22831.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=111bp|location=Sequence derived from alignment at M-pyrifera_M_contig99249:171..281- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99249:171..281- >mRNA_M-pyrifera_M_contig99249.22831.1 ID=mRNA_M-pyrifera_M_contig99249.22831.1|Name=mRNA_M-pyrifera_M_contig99249.22831.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=222bp|location=Sequence derived from alignment at M-pyrifera_M_contig99249:171..281- (Macrocystis pyrifera P11B4 male)back to top |