mRNA_M-pyrifera_M_contig99105.22805.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: UPI000E1DE079 (uncharacterized protein LOC101265259 isoform X3 n=1 Tax=Solanum lycopersicum TaxID=4081 RepID=UPI000E1DE079) HSP 1 Score: 54.3 bits (129), Expect = 5.170e-8 Identity = 27/50 (54.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 4 FPSILFQPFFAAE--RKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 FP L Q F + R+AEAS++R +TDR+PVIVE+A+RSD+P I K K Sbjct: 41 FPPFLVQSFSTKKEKRRAEASRIREKYTDRIPVIVEKAERSDIPNIDKKK 90
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: UPI000532B144 (autophagy-related protein 8f isoform X2 n=1 Tax=Solanum lycopersicum TaxID=4081 RepID=UPI000532B144) HSP 1 Score: 54.3 bits (129), Expect = 9.590e-8 Identity = 27/50 (54.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 4 FPSILFQPFFAAE--RKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 FP L Q F + R+AEAS++R +TDR+PVIVE+A+RSD+P I K K Sbjct: 41 FPPFLVQSFSTKKEKRRAEASRIREKYTDRIPVIVEKAERSDIPNIDKKK 90
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: A0A445HN73_GLYSO (Autophagy-related protein (Fragment) n=2 Tax=Glycine soja TaxID=3848 RepID=A0A445HN73_GLYSO) HSP 1 Score: 53.5 bits (127), Expect = 1.980e-7 Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 10 SILFQPFFAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 S L++ F R+AEAS++R + DR+PVIVERA++SDVPEI K K Sbjct: 47 SNLWKHFMPERRQAEASRIREKYPDRIPVIVERAEKSDVPEIDKKK 92
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: A0A2P6S294_ROSCH (Autophagy-related protein n=1 Tax=Rosa chinensis TaxID=74649 RepID=A0A2P6S294_ROSCH) HSP 1 Score: 52.0 bits (123), Expect = 3.650e-7 Identity = 23/36 (63.89%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 40 ERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 +R+AEA+++R + DRVPVIVERA++SDVP+I KNK Sbjct: 14 QREAEAARIRENYPDRVPVIVERAEKSDVPDIEKNK 49
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: UPI00080A57AD (autophagy-related protein 8f isoform X3 n=2 Tax=Vigna TaxID=3913 RepID=UPI00080A57AD) HSP 1 Score: 51.2 bits (121), Expect = 5.270e-7 Identity = 22/40 (55.00%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 28 FFAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 FF +R+AEA+++R + DR+PVIVE+A+RSD+P I K K Sbjct: 14 FFPEKRRAEAARIREKYPDRIPVIVEKAERSDIPSIDKKK 53
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: A0A6N2B6J8_SOLCI (Autophagy-related protein n=2 Tax=asterids TaxID=71274 RepID=A0A6N2B6J8_SOLCI) HSP 1 Score: 51.2 bits (121), Expect = 7.290e-7 Identity = 24/46 (52.17%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 10 SILFQPFFAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 S+ Q +R+AEAS++R +TDR+PVIVE+A+RSD+P I K K Sbjct: 4 SLFKQEHDLEKRRAEASRIREKYTDRIPVIVEKAERSDIPNIDKKK 49
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: M1AXH6_SOLTU (Autophagy-related protein n=2 Tax=Solanum TaxID=4107 RepID=M1AXH6_SOLTU) HSP 1 Score: 50.8 bits (120), Expect = 1.090e-6 Identity = 22/36 (61.11%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 ERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 +R+AEAS++R +TDR+PVIVE+A+RSD+P I K K Sbjct: 14 KRRAEASRIREKYTDRIPVIVEKAERSDIPNIDKKK 49
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: A0A4S4E0D2_CAMSI (Autophagy-related protein n=5 Tax=Camellia sinensis TaxID=4442 RepID=A0A4S4E0D2_CAMSI) HSP 1 Score: 50.8 bits (120), Expect = 1.150e-6 Identity = 24/46 (52.17%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 10 SILFQPFFAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 +I+FQ F+ +R+AEA+++R + DR+PVIVE+A+RSD+P I K K Sbjct: 9 NIVFQ--FSDKRRAEAARIREKYPDRIPVIVEKAERSDIPNIDKKK 52
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: I1LRP9_SOYBN (Autophagy-related protein n=3 Tax=fabids TaxID=91835 RepID=I1LRP9_SOYBN) HSP 1 Score: 50.1 bits (118), Expect = 1.230e-6 Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 1 Query: 43 RKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 R+AEAS++R + DR+PVIVERA++SDVPEI K K Sbjct: 15 RQAEASRIREKYPDRIPVIVERAEKSDVPEIDKKK 49
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Match: UPI001BF20C2C (Uncharacterized protein n=4 Tax=Carya illinoinensis TaxID=32201 RepID=UPI001BF20C2C) HSP 1 Score: 50.8 bits (120), Expect = 1.240e-6 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 31 FAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNK 147 FA +R+AEA+++R + DR+PVIVE+A+RSD+P I K K Sbjct: 23 FAEQRRAEAARIRKKYADRIPVIVEKAERSDIPYIDKKK 61 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99105.22805.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99105.22805.1 >prot_M-pyrifera_M_contig99105.22805.1 ID=prot_M-pyrifera_M_contig99105.22805.1|Name=mRNA_M-pyrifera_M_contig99105.22805.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bp LFPSILFQPFFAAERKAEASKVRSGFTDRVPVIVERAKRSDVPEISKNKback to top mRNA from alignment at M-pyrifera_M_contig99105:419..565+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99105.22805.1 ID=mRNA_M-pyrifera_M_contig99105.22805.1|Name=mRNA_M-pyrifera_M_contig99105.22805.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=147bp|location=Sequence derived from alignment at M-pyrifera_M_contig99105:419..565+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99105:419..565+ >mRNA_M-pyrifera_M_contig99105.22805.1 ID=mRNA_M-pyrifera_M_contig99105.22805.1|Name=mRNA_M-pyrifera_M_contig99105.22805.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig99105:419..565+ (Macrocystis pyrifera P11B4 male)back to top |