mRNA_M-pyrifera_M_contig99078.22794.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99078.22794.1 vs. uniprot
Match: A0A7S2DJI8_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2DJI8_9EUKA) HSP 1 Score: 49.7 bits (117), Expect = 9.120e-5 Identity = 36/87 (41.38%), Postives = 42/87 (48.28%), Query Frame = 1 Query: 31 RKFHSAMQFRG--QVLVYGGVGANGEVLNDLAVFDAASNQWLDPSARLRRLGVTPPARFAMAFFTVSESQLALYGGAEASGSANRDL 285 RK HS M F G Q +YGG GA+ E+L+DL VFD QW P A L P R A V+E L +YGG G L Sbjct: 89 RKNHS-MTFGGTSQFWIYGGRGADDELLSDLFVFDMQEEQWSQPQA----LSTPPEPRENHAACFVAERYLVIYGGTNDEGEVLNSL 170 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99078.22794.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99078.22794.1 >prot_M-pyrifera_M_contig99078.22794.1 ID=prot_M-pyrifera_M_contig99078.22794.1|Name=mRNA_M-pyrifera_M_contig99078.22794.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bp MARKPGWPAARKFHSAMQFRGQVLVYGGVGANGEVLNDLAVFDAASNQWLback to top mRNA from alignment at M-pyrifera_M_contig99078:349..642- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99078.22794.1 ID=mRNA_M-pyrifera_M_contig99078.22794.1|Name=mRNA_M-pyrifera_M_contig99078.22794.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig99078:349..642- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99078:349..642- >mRNA_M-pyrifera_M_contig99078.22794.1 ID=mRNA_M-pyrifera_M_contig99078.22794.1|Name=mRNA_M-pyrifera_M_contig99078.22794.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=588bp|location=Sequence derived from alignment at M-pyrifera_M_contig99078:349..642- (Macrocystis pyrifera P11B4 male)back to top |