mRNA_M-pyrifera_M_contig95689.22061.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95689.22061.1 vs. uniprot
Match: A0A0W8DA93_PHYNI (Uncharacterized protein n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8DA93_PHYNI) HSP 1 Score: 67.8 bits (164), Expect = 4.190e-12 Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 4 VWYNVGTLYDSCNQTTDALDAYNKAAELGASGGFIHERI 120 VWYNVGTLYD+CNQT+DA DAY KAAELGA FI ER+ Sbjct: 133 VWYNVGTLYDTCNQTSDARDAYQKAAELGADAQFIRERL 171 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95689.22061.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig95689.22061.1 >prot_M-pyrifera_M_contig95689.22061.1 ID=prot_M-pyrifera_M_contig95689.22061.1|Name=mRNA_M-pyrifera_M_contig95689.22061.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp QVWYNVGTLYDSCNQTTDALDAYNKAAELGASGGFIHERIAALback to top mRNA from alignment at M-pyrifera_M_contig95689:259..387+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig95689.22061.1 ID=mRNA_M-pyrifera_M_contig95689.22061.1|Name=mRNA_M-pyrifera_M_contig95689.22061.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=129bp|location=Sequence derived from alignment at M-pyrifera_M_contig95689:259..387+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig95689:259..387+ >mRNA_M-pyrifera_M_contig95689.22061.1 ID=mRNA_M-pyrifera_M_contig95689.22061.1|Name=mRNA_M-pyrifera_M_contig95689.22061.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig95689:259..387+ (Macrocystis pyrifera P11B4 male)back to top |