mRNA_M-pyrifera_M_contig93319.21551.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93319.21551.1 vs. uniprot
Match: A0A1M5CRY8_9BACT (Uncharacterized protein n=1 Tax=Cnuella takakiae TaxID=1302690 RepID=A0A1M5CRY8_9BACT) HSP 1 Score: 60.8 bits (146), Expect = 3.810e-9 Identity = 32/75 (42.67%), Postives = 51/75 (68.00%), Query Frame = 1 Query: 46 NFKDEIARIISLYVPIATGVLGVVGLILVGIFIYK-----CEYDKAVDT----LKYVFTALLPIWGTWIGTVLAF 243 + KD +AR I++YV + TGVLG +G+ LV + +++ E D+ VD L++VF ++LP+ GTW+GT+LAF Sbjct: 6 DIKDLLARKITMYVLVCTGVLGTLGIALVLVVLFRKGDTAAETDQMVDNGLKVLQFVFASILPLLGTWLGTILAF 80
BLAST of mRNA_M-pyrifera_M_contig93319.21551.1 vs. uniprot
Match: A0A5B8UKV0_9BACT (Uncharacterized protein n=1 Tax=Flavisolibacter ginsenosidimutans TaxID=661481 RepID=A0A5B8UKV0_9BACT) HSP 1 Score: 54.3 bits (129), Expect = 1.040e-6 Identity = 31/77 (40.26%), Postives = 51/77 (66.23%), Query Frame = 1 Query: 22 NTEATTNGN-FKDEIARIISLYVPIATGVLGVVGLIL--VGIFIYKCEYDKAVDTLKYVFTALLPIWGTWIGTVLAF 243 N AT N ++++AR +S+ V + T VLGV+G+ + V + K + A D L+ +F+A+LP++GTWIGT+LA+ Sbjct: 6 NNPATQTANPVQEKVARTVSIIVLVGTCVLGVLGMAIAIVALTTKKEDIAGAKDILQILFSAILPLFGTWIGTILAY 82 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93319.21551.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93319.21551.1 >prot_M-pyrifera_M_contig93319.21551.1 ID=prot_M-pyrifera_M_contig93319.21551.1|Name=mRNA_M-pyrifera_M_contig93319.21551.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=81bp MSNPTPPNTEATTNGNFKDEIARIISLYVPIATGVLGVVGLILVGIFIYKback to top mRNA from alignment at M-pyrifera_M_contig93319:513..755+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93319.21551.1 ID=mRNA_M-pyrifera_M_contig93319.21551.1|Name=mRNA_M-pyrifera_M_contig93319.21551.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=243bp|location=Sequence derived from alignment at M-pyrifera_M_contig93319:513..755+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93319:513..755+ >mRNA_M-pyrifera_M_contig93319.21551.1 ID=mRNA_M-pyrifera_M_contig93319.21551.1|Name=mRNA_M-pyrifera_M_contig93319.21551.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=486bp|location=Sequence derived from alignment at M-pyrifera_M_contig93319:513..755+ (Macrocystis pyrifera P11B4 male)back to top |