mRNA_M-pyrifera_M_contig93169.21526.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93169.21526.1 vs. uniprot
Match: A0A5A8EBP6_CAFRO (Ubiquitin-like domain-containing protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8EBP6_CAFRO) HSP 1 Score: 75.5 bits (184), Expect = 1.810e-14 Identity = 39/79 (49.37%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 4 EFWSTRTSGARERWDALKLACESLLQEPPDVGLAGEVLSAADLRCP-TGNLAEVYDARGRLYAVPRYCYQTPANVMSTE 237 +FWSTRT + W+AL L ++LLQ D GLA +L + LR L+EV+D RG+LY VPRYC+QTP NV S + Sbjct: 76 QFWSTRTENQPQAWEALHLCADTLLQG--DAGLAHTILVESGLRVGGRAGLSEVWDPRGQLYRVPRYCWQTPGNVASDD 152
BLAST of mRNA_M-pyrifera_M_contig93169.21526.1 vs. uniprot
Match: A0A8H4W4U4_9HELO (Ubiquitin-like domain-containing protein n=1 Tax=Cudoniella acicularis TaxID=354080 RepID=A0A8H4W4U4_9HELO) HSP 1 Score: 52.4 bits (124), Expect = 5.170e-6 Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 1 Query: 7 FWSTRTSGARERWDALKLACESLLQ--EPPD----VGLAGEVLSAADLRCPTGNLAE--VYDARGRLYAVPRYCYQTPANVMSTED 240 F+ TRT+G E W L+ A E L EP D VG A ++L AAD+ PTG+LA +DA G Y +P P N++++ + Sbjct: 143 FFDTRTAGRTEIWQTLRAALEILWAGGEPEDHDGGVGTAQQILDAADITIPTGDLAVGGAFDAFGVHYKMPPEIVSDPENIVASPE 228
BLAST of mRNA_M-pyrifera_M_contig93169.21526.1 vs. uniprot
Match: A0A2J6SD51_9HELO (Ubiquitin-like domain-containing protein n=2 Tax=Hyaloscypha hepaticicola/Rhizoscyphus ericae species complex TaxID=186449 RepID=A0A2J6SD51_9HELO) HSP 1 Score: 51.6 bits (122), Expect = 8.880e-6 Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 1 Query: 4 EFWSTRTSGARERWDALKLACESLLQEPPD------VGLAGEVLSAADLRCPTGNLAE--VYDARGRLYAVPRYCYQTPANV 225 EF+ TR +G E W ++ E L + +G A ++L AAD+ PTG+LA VYD+ G Y++P Y P N+ Sbjct: 89 EFFDTRVTGRSEVWQTVQQVLELLWSGGDEGDTDGGLGTAQQILDAADITIPTGDLATGGVYDSLGAHYSLPEYIVSDPQNI 170 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93169.21526.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93169.21526.1 >prot_M-pyrifera_M_contig93169.21526.1 ID=prot_M-pyrifera_M_contig93169.21526.1|Name=mRNA_M-pyrifera_M_contig93169.21526.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=80bp QEFWSTRTSGARERWDALKLACESLLQEPPDVGLAGEVLSAADLRCPTGNback to top mRNA from alignment at M-pyrifera_M_contig93169:314..553+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93169.21526.1 ID=mRNA_M-pyrifera_M_contig93169.21526.1|Name=mRNA_M-pyrifera_M_contig93169.21526.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig93169:314..553+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93169:314..553+ >mRNA_M-pyrifera_M_contig93169.21526.1 ID=mRNA_M-pyrifera_M_contig93169.21526.1|Name=mRNA_M-pyrifera_M_contig93169.21526.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=480bp|location=Sequence derived from alignment at M-pyrifera_M_contig93169:314..553+ (Macrocystis pyrifera P11B4 male)back to top |