mRNA_M-pyrifera_M_contig93063.21507.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93063.21507.1 vs. uniprot
Match: UPI0015D0CC2D (E3 ubiquitin-protein ligase TRIM47-like n=1 Tax=Electrophorus electricus TaxID=8005 RepID=UPI0015D0CC2D) HSP 1 Score: 52.0 bits (123), Expect = 1.240e-5 Identity = 25/63 (39.68%), Postives = 34/63 (53.97%), Query Frame = 1 Query: 127 NRLHSHSTDS-------HFTQ---RPPTVVHVDAICDGCGMFPLVGPRFQCRERPDVVLCVAC 285 N++ +H +S H TQ +P VH ICDGC MFP++GPRF+C + D C C Sbjct: 350 NKIITHGDESVELQDPGHQTQAMPQPHPNVHPTIICDGCNMFPMIGPRFKCLDCNDFDFCEIC 412
BLAST of mRNA_M-pyrifera_M_contig93063.21507.1 vs. uniprot
Match: A0A835PND7_VANPL (Uncharacterized protein n=2 Tax=Vanilla planifolia TaxID=51239 RepID=A0A835PND7_VANPL) HSP 1 Score: 49.7 bits (117), Expect = 8.430e-5 Identity = 22/60 (36.67%), Postives = 33/60 (55.00%), Query Frame = 1 Query: 109 AGAWGDNRL-HSHSTDSHFTQRPPTVVHVDAICDGCGMFPLVGPRFQCRERPDVVLCVAC 285 A A+ +RL H + + R H ICDGCGM P++GPR++ + + LC+AC Sbjct: 289 ANAFRGHRLQHPYGRFCSYDGRTSRAFHRGVICDGCGMHPIMGPRYKSTVKDNYDLCIAC 348
BLAST of mRNA_M-pyrifera_M_contig93063.21507.1 vs. uniprot
Match: A0A7S3DZD4_9CHLO (Hypothetical protein n=1 Tax=Chloropicon laureae TaxID=464258 RepID=A0A7S3DZD4_9CHLO) HSP 1 Score: 48.9 bits (115), Expect = 9.020e-5 Identity = 22/44 (50.00%), Postives = 26/44 (59.09%), Query Frame = 1 Query: 163 TQRPPTVVHVDAICDGCGMFPLVGPRFQC---RERPDVVLCVAC 285 T RP VH CDGCG+ P+VGPR+QC +ER LC C Sbjct: 58 TIRPENFVHFGVGCDGCGVCPIVGPRWQCTECKERIGFDLCAEC 101 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93063.21507.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93063.21507.1 >prot_M-pyrifera_M_contig93063.21507.1 ID=prot_M-pyrifera_M_contig93063.21507.1|Name=mRNA_M-pyrifera_M_contig93063.21507.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=95bp HYGVTCSACRSSPIVGVCHLCRAVDCDVRLCDTCFRAGAWGDNRLHSHSTback to top mRNA from alignment at M-pyrifera_M_contig93063:394..678+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93063.21507.1 ID=mRNA_M-pyrifera_M_contig93063.21507.1|Name=mRNA_M-pyrifera_M_contig93063.21507.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=285bp|location=Sequence derived from alignment at M-pyrifera_M_contig93063:394..678+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93063:394..678+ >mRNA_M-pyrifera_M_contig93063.21507.1 ID=mRNA_M-pyrifera_M_contig93063.21507.1|Name=mRNA_M-pyrifera_M_contig93063.21507.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=570bp|location=Sequence derived from alignment at M-pyrifera_M_contig93063:394..678+ (Macrocystis pyrifera P11B4 male)back to top |