mRNA_M-pyrifera_M_contig91718.21249.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91718.21249.1 vs. uniprot
Match: F2ARS5_RHOBT (Uncharacterized protein n=1 Tax=Rhodopirellula baltica WH47 TaxID=991778 RepID=F2ARS5_RHOBT) HSP 1 Score: 46.2 bits (108), Expect = 1.160e-5 Identity = 22/28 (78.57%), Postives = 22/28 (78.57%), Query Frame = -1 Query: 46 LELPRWGVGKKRNQQRIIRVNTKD*TVQ 129 LELPRWG GK RNQQRI RVNTK VQ Sbjct: 6 LELPRWGEGKNRNQQRIFRVNTKHLAVQ 33 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91718.21249.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91718.21249.1 >prot_M-pyrifera_M_contig91718.21249.1 ID=prot_M-pyrifera_M_contig91718.21249.1|Name=mRNA_M-pyrifera_M_contig91718.21249.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp AETLGLNPVSRLGVRLDCSIFSVDTDDALLVSLLSYAPTGQL*back to top mRNA from alignment at M-pyrifera_M_contig91718:593..721+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91718.21249.1 ID=mRNA_M-pyrifera_M_contig91718.21249.1|Name=mRNA_M-pyrifera_M_contig91718.21249.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=129bp|location=Sequence derived from alignment at M-pyrifera_M_contig91718:593..721+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91718:593..721+ >mRNA_M-pyrifera_M_contig91718.21249.1 ID=mRNA_M-pyrifera_M_contig91718.21249.1|Name=mRNA_M-pyrifera_M_contig91718.21249.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig91718:593..721+ (Macrocystis pyrifera P11B4 male)back to top |