mRNA_M-pyrifera_M_contig90840.21055.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90840.21055.1 vs. uniprot
Match: A0A0C2WEK9_9AGAM (U3 small nucleolar RNA-associated protein 22 n=1 Tax=Serendipita vermifera MAFF 305830 TaxID=933852 RepID=A0A0C2WEK9_9AGAM) HSP 1 Score: 53.5 bits (127), Expect = 2.160e-6 Identity = 31/90 (34.44%), Postives = 49/90 (54.44%), Query Frame = 1 Query: 1 PLLSAWLRFERSSKWPQDVGAIASLKVALVLRLAKALRGAPNVEHAR--------GLADGSLL--VHVKGFAFRVRVLHPPELAIFRRAV 240 P+ A L+FE+S++WP D+GAI LK+A +A+ + HAR + DG+ + V G+AFR+R+ H E + RA+ Sbjct: 812 PVYDAVLQFEKSARWPDDLGAIQKLKLAWFETIAREFTNKLDGSHARIAMDALASPVEDGAAVEVVLATGYAFRLRIYHDREKFLLERAI 901
BLAST of mRNA_M-pyrifera_M_contig90840.21055.1 vs. uniprot
Match: A0A183ESK7_9BILA (Nucleolar protein 6 n=1 Tax=Gongylonema pulchrum TaxID=637853 RepID=A0A183ESK7_9BILA) HSP 1 Score: 49.3 bits (116), Expect = 5.040e-5 Identity = 27/78 (34.62%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 1 PLLSAWLRFERSSKWPQDVGAIASLKVALVLRLAKALRGAPNVEHARGLADGSLLVHVKGFAFRVRVLHPPELAIFRR 234 P + L E+S KW +++GAIA LK A + LAK L+ +++ D L+VH FR+ + +P E+ I R+ Sbjct: 102 PSIEVQLTMEQSGKWGEELGAIARLKTAFYVELAKILKEKYSMQAVP--FDDYLIVHFNTVVFRLVIAYPKEVHIMRK 177
BLAST of mRNA_M-pyrifera_M_contig90840.21055.1 vs. uniprot
Match: A0A0G4ISB4_PLABS (Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4ISB4_PLABS) HSP 1 Score: 49.3 bits (116), Expect = 6.710e-5 Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 1 Query: 4 LLSAWLRFERSSKWPQDVGAIASLKVALVLRLAKALR--GAPNVEHARGLADGSLLVHVKGFAFRVRVLHPPELAIFR 231 +L ++FE SS+WP+D+ AIA +K A+ +R+A L+ G P + L + G AFRV + H E+AI R Sbjct: 587 MLPVVVQFESSSRWPEDLSAIARIKSAVHIRMAATLQEQGVPATAFLM-----ATLCWIDGVAFRVEIFHAREIAIRR 659 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90840.21055.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90840.21055.1 >prot_M-pyrifera_M_contig90840.21055.1 ID=prot_M-pyrifera_M_contig90840.21055.1|Name=mRNA_M-pyrifera_M_contig90840.21055.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=80bp PLLSAWLRFERSSKWPQDVGAIASLKVALVLRLAKALRGAPNVEHARGLAback to top mRNA from alignment at M-pyrifera_M_contig90840:173..412- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90840.21055.1 ID=mRNA_M-pyrifera_M_contig90840.21055.1|Name=mRNA_M-pyrifera_M_contig90840.21055.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig90840:173..412- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90840:173..412- >mRNA_M-pyrifera_M_contig90840.21055.1 ID=mRNA_M-pyrifera_M_contig90840.21055.1|Name=mRNA_M-pyrifera_M_contig90840.21055.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=480bp|location=Sequence derived from alignment at M-pyrifera_M_contig90840:173..412- (Macrocystis pyrifera P11B4 male)back to top |