mRNA_M-pyrifera_M_contig90289.20934.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90289.20934.1 vs. uniprot
Match: A0A497LBI1_9ARCH (Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A497LBI1_9ARCH) HSP 1 Score: 53.9 bits (128), Expect = 9.150e-6 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 31 IGAYNPDTATFFLRNANSSGDADVAVFNYGIPGWVPLVG 147 +G Y+P TATFFLRN+NSSG AD+ F YG P W+P+ G Sbjct: 1 MGVYDPSTATFFLRNSNSSGFADIT-FVYGNPNWIPIAG 38
BLAST of mRNA_M-pyrifera_M_contig90289.20934.1 vs. uniprot
Match: A0A1G2JCH4_9BACT (NodB homology domain-containing protein n=1 Tax=Candidatus Staskawiczbacteria bacterium RIFOXYC1_FULL_38_18 TaxID=1802229 RepID=A0A1G2JCH4_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 2.730e-5 Identity = 25/40 (62.50%), Postives = 31/40 (77.50%), Query Frame = 1 Query: 1 GDWDGDGTDTIGAYNPDTATFFLRNANSSGDADVAVFNYG 120 GDWDGDGT TIG YN T+ F+LRN+N++G AD+ F YG Sbjct: 50 GDWDGDGTATIGLYNLKTSIFYLRNSNTTGVADIT-FGYG 88
BLAST of mRNA_M-pyrifera_M_contig90289.20934.1 vs. uniprot
Match: A0A841BJS5_9ACTN (Uncharacterized protein n=1 Tax=Allocatelliglobosispora scoriae TaxID=643052 RepID=A0A841BJS5_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 4.670e-5 Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1 Query: 1 GDWDGDGTDTIGAYNPDTATFFLRNANSSGDADVAVFNYGIPG 129 GDW+GDGT TIG+++ ++TF+L+N+NSSG AD VF YG G Sbjct: 202 GDWNGDGTTTIGSWDTASSTFYLKNSNSSGAADY-VFGYGCSG 243
BLAST of mRNA_M-pyrifera_M_contig90289.20934.1 vs. uniprot
Match: A0A3A0G2M8_9PROT (Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A3A0G2M8_9PROT) HSP 1 Score: 52.0 bits (123), Expect = 5.020e-5 Identity = 23/41 (56.10%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 1 GDWDGDGTDTIGAYNPDTATFFLRNANSSGDADVAVFNYGI 123 GDW+GDG+ TIG+Y P FFLRNANS+G AD F + + Sbjct: 164 GDWNGDGSSTIGSYAPAIERFFLRNANSAGAADAGNFKFNV 204 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90289.20934.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90289.20934.1 >prot_M-pyrifera_M_contig90289.20934.1 ID=prot_M-pyrifera_M_contig90289.20934.1|Name=mRNA_M-pyrifera_M_contig90289.20934.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=149bp GDWDGDGTDTIGAYNPDTATFFLRNANSSGDADVAVFNYGIPGWVPLVGDback to top mRNA from alignment at M-pyrifera_M_contig90289:3..449+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90289.20934.1 ID=mRNA_M-pyrifera_M_contig90289.20934.1|Name=mRNA_M-pyrifera_M_contig90289.20934.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=447bp|location=Sequence derived from alignment at M-pyrifera_M_contig90289:3..449+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90289:3..449+ >mRNA_M-pyrifera_M_contig90289.20934.1 ID=mRNA_M-pyrifera_M_contig90289.20934.1|Name=mRNA_M-pyrifera_M_contig90289.20934.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=894bp|location=Sequence derived from alignment at M-pyrifera_M_contig90289:3..449+ (Macrocystis pyrifera P11B4 male)back to top |