mRNA_M-pyrifera_M_contig89983.20853.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89983.20853.1 vs. uniprot
Match: A0A7C2B262_9BACT (Glycosyltransferase family 1 protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C2B262_9BACT) HSP 1 Score: 87.4 bits (215), Expect = 8.550e-18 Identity = 51/120 (42.50%), Postives = 68/120 (56.67%), Query Frame = 1 Query: 1 LGVAANVHWIQDDPAAH-PELFGTATLFVAPGADERASSRWPCAALAAGLPILAADVERHRWAVAHEERGLLVPEQTRAAWEAALTRSATAPVARERWGRSARAFAEEHLDWAHIAARFE 357 LG+ + V W+ P L G +TLF P + R ALA GLP+LA+D+ R R +V GLLV AW A+ R+A++PVAR+RW R AR +AEEHL W +A+ FE Sbjct: 269 LGIGSRVTWLPRPRREELPGLMGASTLFAVPAVGDTVVGRQLGRALACGLPVLASDLPRLRDSVEDGRVGLLVEPGNVEAWVDAIGRAASSPVARKRWSREARRYAEEHLSWDRVASEFE 388 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89983.20853.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89983.20853.1 >prot_M-pyrifera_M_contig89983.20853.1 ID=prot_M-pyrifera_M_contig89983.20853.1|Name=mRNA_M-pyrifera_M_contig89983.20853.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=122bp LGVAANVHWIQDDPAAHPELFGTATLFVAPGADERASSRWPCAALAAGLPback to top mRNA from alignment at M-pyrifera_M_contig89983:431..796- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89983.20853.1 ID=mRNA_M-pyrifera_M_contig89983.20853.1|Name=mRNA_M-pyrifera_M_contig89983.20853.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=366bp|location=Sequence derived from alignment at M-pyrifera_M_contig89983:431..796- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89983:431..796- >mRNA_M-pyrifera_M_contig89983.20853.1 ID=mRNA_M-pyrifera_M_contig89983.20853.1|Name=mRNA_M-pyrifera_M_contig89983.20853.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=732bp|location=Sequence derived from alignment at M-pyrifera_M_contig89983:431..796- (Macrocystis pyrifera P11B4 male)back to top |