mRNA_M-pyrifera_M_contig89784.20813.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89784.20813.1 vs. uniprot
Match: A0A396JAS7_MEDTR (Putative RNA-directed DNA polymerase n=3 Tax=Medicago truncatula TaxID=3880 RepID=A0A396JAS7_MEDTR) HSP 1 Score: 49.7 bits (117), Expect = 3.060e-5 Identity = 24/61 (39.34%), Postives = 38/61 (62.30%), Query Frame = 1 Query: 28 WVSDNGSTNHVTSDARNVYDWVEIPPGKERVLIGDGKGMRVTGVGSLNLK--MHSKTDFNV 204 W D+G+T+HVT DA N+ D + G ++V IG+G+G+ +T VGSL +H +T + Sbjct: 336 WYPDSGATHHVTPDASNLMDSTSLS-GSDQVHIGNGQGLAITSVGSLQFTSPLHPQTTLKL 395 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89784.20813.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89784.20813.1 >prot_M-pyrifera_M_contig89784.20813.1 ID=prot_M-pyrifera_M_contig89784.20813.1|Name=mRNA_M-pyrifera_M_contig89784.20813.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bp IRRPPGSEHWVSDNGSTNHVTSDARNVYDWVEIPPGKERVLIGDGKGMRVback to top mRNA from alignment at M-pyrifera_M_contig89784:300..503+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89784.20813.1 ID=mRNA_M-pyrifera_M_contig89784.20813.1|Name=mRNA_M-pyrifera_M_contig89784.20813.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=204bp|location=Sequence derived from alignment at M-pyrifera_M_contig89784:300..503+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89784:300..503+ >mRNA_M-pyrifera_M_contig89784.20813.1 ID=mRNA_M-pyrifera_M_contig89784.20813.1|Name=mRNA_M-pyrifera_M_contig89784.20813.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=408bp|location=Sequence derived from alignment at M-pyrifera_M_contig89784:300..503+ (Macrocystis pyrifera P11B4 male)back to top |