mRNA_M-pyrifera_M_contig89537.20757.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A6V7IZ85_9HYME (Uncharacterized protein (Fragment) n=1 Tax=Bracon brevicornis TaxID=1563983 RepID=A0A6V7IZ85_9HYME) HSP 1 Score: 58.2 bits (139), Expect = 8.400e-10 Identity = 26/65 (40.00%), Postives = 40/65 (61.54%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFVAKP 195 G R ++ C +E+GAVVPP++++ F+ + G PA P+ LPEC EL T+ +Y HF+ P Sbjct: 1 GRRCILKDCCYIEDGAVVPPETIVPSFTKFAGNPAVPV-DDLPECTLELMVDYTKNYYQHFLPGP 64
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A6P3X098_DINQU (dynactin subunit 5 n=9 Tax=Aculeata TaxID=7434 RepID=A0A6P3X098_DINQU) HSP 1 Score: 59.3 bits (142), Expect = 3.340e-9 Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R+V+ C +E+GAVVPP++++ F+ + G PA ++LPEC +L T T+ +Y+HF+ Sbjct: 117 GRRSVLKDCCYIEDGAVVPPETIVPSFTRFAGSPAT-CVEELPECTVDLMTDFTKNYYEHFL 177
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A2A3EMM8_APICC (Dynactin subunit n=1 Tax=Apis cerana cerana TaxID=94128 RepID=A0A2A3EMM8_APICC) HSP 1 Score: 57.0 bits (136), Expect = 1.410e-8 Identity = 26/66 (39.39%), Postives = 40/66 (60.61%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFVAKPA 198 G R V+ C +E+GAVVPP++V+ F+ + G PA+ + LPEC +L T+ +Y HF+ A Sbjct: 81 GRRCVLKDCCYIEDGAVVPPETVVPSFTRFAGNPAK-CVEDLPECTLDLMLEFTKNYYQHFLPSTA 145
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: UPI000C715D7D (dynactin subunit 5 isoform X1 n=1 Tax=Orussus abietinus TaxID=222816 RepID=UPI000C715D7D) HSP 1 Score: 56.6 bits (135), Expect = 3.710e-8 Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R ++ CS +E+GAVVPP++VI F+ + G PA + LPEC +L T+++Y HF+ Sbjct: 120 GRRCILKDCSYIEDGAVVPPETVIPSFTRFSGNPAV-CVEDLPECTQDLMLDFTKDYYQHFL 180
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A6V7H959_9HYME (Hypothetical protein (Fragment) n=1 Tax=Heterotrigona itama TaxID=395501 RepID=A0A6V7H959_9HYME) HSP 1 Score: 56.6 bits (135), Expect = 3.960e-8 Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R V+ C +E+GAVVPP++VI F+ + G PA+ + LPEC +L T+ +Y HF+ Sbjct: 128 GRRCVLKDCCYIEDGAVVPPETVIPSFTRFAGNPAK-CVEDLPECTLDLMLEFTKNYYQHFL 188
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: UPI000623B6F1 (dynactin subunit 5 isoform X1 n=3 Tax=Linepithema humile TaxID=83485 RepID=UPI000623B6F1) HSP 1 Score: 56.6 bits (135), Expect = 5.400e-8 Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R+V+ C +E+GAVVPP++V+ F+ + G PA ++LPEC +L T+ +Y+HF+ Sbjct: 152 GRRSVLKDCCYIEDGAVVPPETVVPSFTRFAGNPAT-CVEELPECTLDLMIDFTKNYYEHFL 212
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A7M6USL0_NASVI (Uncharacterized protein n=5 Tax=Chalcidoidea TaxID=7422 RepID=A0A7M6USL0_NASVI) HSP 1 Score: 55.5 bits (132), Expect = 9.920e-8 Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R+++ C +E+GAV+PP++V+ F+ + G PA+ + LPEC +L T+ +Y HF+ Sbjct: 117 GRRSILKSCCYIEDGAVIPPETVVPSFTRFAGNPAK-CVEDLPECTLDLMLDFTKNYYQHFL 177
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A7J8IX26_MOLMO (Dynactin subunit 5 n=2 Tax=Microchiroptera TaxID=30560 RepID=A0A7J8IX26_MOLMO) HSP 1 Score: 50.4 bits (119), Expect = 2.260e-6 Identity = 21/62 (33.87%), Postives = 37/62 (59.68%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R V+ C ++ + V+PP++V+ PF+++ G P + +LPEC EL T+ +Y F+ Sbjct: 40 GRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGL-FSGELPECTQELMIDVTKSYYQKFL 100
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A6P6BLB3_PTEVA (dynactin subunit 5 n=1 Tax=Pteropus vampyrus TaxID=132908 RepID=A0A6P6BLB3_PTEVA) HSP 1 Score: 51.6 bits (122), Expect = 4.230e-6 Identity = 22/62 (35.48%), Postives = 37/62 (59.68%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFV 186 G R V+ C R+ + V+PP++V+ PF+++ G P + +LPEC EL T+ +Y F+ Sbjct: 161 GRRCVLKDCCRILDNTVLPPETVVPPFTVFSGCPGL-FSGELPECTQELMIDVTKSYYQKFL 221
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Match: A0A8C7K3Q5_ONCKI (Uncharacterized protein n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=A0A8C7K3Q5_ONCKI) HSP 1 Score: 49.7 bits (117), Expect = 6.180e-6 Identity = 20/63 (31.75%), Postives = 38/63 (60.32%), Query Frame = 1 Query: 1 GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQTRATREFYDHFVA 189 G R V+ C ++ + V+PP++V+ PF+++ G P + +LPEC +L T+ +Y F++ Sbjct: 56 GRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGL-FSGELPECTQDLMIDVTKSYYQKFLS 117 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89537.20757.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 15
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89537.20757.1 >prot_M-pyrifera_M_contig89537.20757.1 ID=prot_M-pyrifera_M_contig89537.20757.1|Name=mRNA_M-pyrifera_M_contig89537.20757.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=67bp GARTVIHPCSRVEEGAVVPPDSVIAPFSIWKGFPARPLAQQLPECWAELQback to top mRNA from alignment at M-pyrifera_M_contig89537:96..407+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89537.20757.1 ID=mRNA_M-pyrifera_M_contig89537.20757.1|Name=mRNA_M-pyrifera_M_contig89537.20757.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=312bp|location=Sequence derived from alignment at M-pyrifera_M_contig89537:96..407+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89537:96..407+ >mRNA_M-pyrifera_M_contig89537.20757.1 ID=mRNA_M-pyrifera_M_contig89537.20757.1|Name=mRNA_M-pyrifera_M_contig89537.20757.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=402bp|location=Sequence derived from alignment at M-pyrifera_M_contig89537:96..407+ (Macrocystis pyrifera P11B4 male)back to top |