mRNA_M-pyrifera_M_contig89057.20647.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89057.20647.1 vs. uniprot
Match: A0A2E0PWI6_9GAMM (Uncharacterized protein n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E0PWI6_9GAMM) HSP 1 Score: 81.6 bits (200), Expect = 5.990e-17 Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 1 Query: 1 FNRAQVAVALGFNGHLDDLPYLEAMSDGDNHYVAQSAITGLSLFGGKRARNILIKLADKYRGTSRGDLMTEMLRHAYRWPP 243 FNRAQV +AL NG+ +D+ YLE M+D +NHY+ Q+AITGL + ++A+N L L K+R SRG L+ E+L +AY+ P Sbjct: 158 FNRAQVIIALALNGNSNDVEYLEKMADSENHYIIQTAITGLGIMSSEKAKNALGILWKKHRENSRGKLIEEVLDYAYKVEP 238 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89057.20647.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89057.20647.1 >prot_M-pyrifera_M_contig89057.20647.1 ID=prot_M-pyrifera_M_contig89057.20647.1|Name=mRNA_M-pyrifera_M_contig89057.20647.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bp FNRAQVAVALGFNGHLDDLPYLEAMSDGDNHYVAQSAITGLSLFGGKRARback to top mRNA from alignment at M-pyrifera_M_contig89057:553..810- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89057.20647.1 ID=mRNA_M-pyrifera_M_contig89057.20647.1|Name=mRNA_M-pyrifera_M_contig89057.20647.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig89057:553..810- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89057:553..810- >mRNA_M-pyrifera_M_contig89057.20647.1 ID=mRNA_M-pyrifera_M_contig89057.20647.1|Name=mRNA_M-pyrifera_M_contig89057.20647.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=516bp|location=Sequence derived from alignment at M-pyrifera_M_contig89057:553..810- (Macrocystis pyrifera P11B4 male)back to top |