mRNA_M-pyrifera_M_contig88853.20621.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Match: A0A1X7VF94_AMPQE (Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VF94_AMPQE) HSP 1 Score: 59.7 bits (143), Expect = 2.370e-8 Identity = 30/72 (41.67%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 22 ASVVHVVAYLEDQHIRQWPVEKRSPLREE-GEGWGSVFVRYLRDAECPFAPDLAPSSSXXXXXXPAVPPSFT 234 A + +V +LEDQ IR + +++R+PLR+E G+ W VF +YL D +CPF+ D AP+ AV FT Sbjct: 30 AQLKSLVIWLEDQKIRHYTIDERTPLRDETGDNWNKVFEKYLTDMQCPFSFDSAPTPCLHWLIDEAVRCEFT 101
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Match: A0A2L2XVB6_PARTP (Uncharacterized protein n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2XVB6_PARTP) HSP 1 Score: 49.7 bits (117), Expect = 9.180e-5 Identity = 29/89 (32.58%), Postives = 39/89 (43.82%), Query Frame = 1 Query: 40 VAYLEDQHIRQWPVEKRSPLRE-EGEGWGSVFVRYLRDAECPFAPDLAPSSSXXXXXXPAVPPSFTPEELHRLVQWLLGQAICVDFEES 303 V +LEDQ IRQ+P+E RSPLR W F YL D CPF E + WLLG A+ +++ ++ Sbjct: 30 VVWLEDQVIRQYPIEDRSPLRNITNAAWEDAFKVYLADLACPFT------------------------EKEEICDWLLGLAVRLEYGDN 94 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig88853.20621.1 >prot_M-pyrifera_M_contig88853.20621.1 ID=prot_M-pyrifera_M_contig88853.20621.1|Name=mRNA_M-pyrifera_M_contig88853.20621.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=106bp LILVAELASVVHVVAYLEDQHIRQWPVEKRSPLREEGEGWGSVFVRYLRDback to top mRNA from alignment at M-pyrifera_M_contig88853:489..806+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig88853.20621.1 ID=mRNA_M-pyrifera_M_contig88853.20621.1|Name=mRNA_M-pyrifera_M_contig88853.20621.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=318bp|location=Sequence derived from alignment at M-pyrifera_M_contig88853:489..806+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig88853:489..806+ >mRNA_M-pyrifera_M_contig88853.20621.1 ID=mRNA_M-pyrifera_M_contig88853.20621.1|Name=mRNA_M-pyrifera_M_contig88853.20621.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=636bp|location=Sequence derived from alignment at M-pyrifera_M_contig88853:489..806+ (Macrocystis pyrifera P11B4 male)back to top |