mRNA_M-pyrifera_M_contig8871.20598.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8871.20598.1 vs. uniprot
Match: A0A6H5KX21_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KX21_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 6.550e-19 Identity = 50/85 (58.82%), Postives = 64/85 (75.29%), Query Frame = 1 Query: 4 REIKVQLGKTDEEMETDPLLSTANLMRFDPLAEEGEF-DLIMQKR-GAIDAAKDNIRMKGDGHEMVIRTDSTSADRLKEAGMPLE 252 RE+KV+LGKTD EM++DP LS NLM FDP AE+G+ +LI Q+R G+IDA +N+RMK GHE V TDST AD + AG+PL+ Sbjct: 556 REVKVELGKTDAEMDSDPSLSMPNLMTFDPDAEDGDPPELIKQERPGSIDAGGENLRMKS-GHEKVFTTDSTPADMARAAGVPLD 639
BLAST of mRNA_M-pyrifera_M_contig8871.20598.1 vs. uniprot
Match: D7FN96_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FN96_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 2.240e-18 Identity = 48/83 (57.83%), Postives = 63/83 (75.90%), Query Frame = 1 Query: 4 REIKVQLGKTDEEMETDPLLSTANLMRFDPLAEEGEF-DLIMQKR-GAIDAAKDNIRMKGDGHEMVIRTDSTSADRLKEAGMP 246 RE+KV+LGKTD EM +DP LS +NLM FDP AE+G+ +L+ Q+R G+IDA +N+RMK GHE V+ TDST AD + AG+P Sbjct: 353 REVKVELGKTDAEMNSDPSLSMSNLMTFDPDAEDGDPPELVKQERPGSIDAGGENLRMKS-GHEKVVTTDSTPADMARAAGVP 434 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8871.20598.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8871.20598.1 >prot_M-pyrifera_M_contig8871.20598.1 ID=prot_M-pyrifera_M_contig8871.20598.1|Name=mRNA_M-pyrifera_M_contig8871.20598.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bp MREIKVQLGKTDEEMETDPLLSTANLMRFDPLAEEGEFDLIMQKRGAIDAback to top mRNA from alignment at M-pyrifera_M_contig8871:6019..7771- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8871.20598.1 ID=mRNA_M-pyrifera_M_contig8871.20598.1|Name=mRNA_M-pyrifera_M_contig8871.20598.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=1753bp|location=Sequence derived from alignment at M-pyrifera_M_contig8871:6019..7771- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8871:6019..7771- >mRNA_M-pyrifera_M_contig8871.20598.1 ID=mRNA_M-pyrifera_M_contig8871.20598.1|Name=mRNA_M-pyrifera_M_contig8871.20598.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=510bp|location=Sequence derived from alignment at M-pyrifera_M_contig8871:6019..7771- (Macrocystis pyrifera P11B4 male)back to top |