mRNA_M-pyrifera_M_contig87583.20341.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7C3ABE1_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7C3ABE1_9BACT) HSP 1 Score: 72.8 bits (177), Expect = 9.220e-15 Identity = 31/54 (57.41%), Postives = 44/54 (81.48%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKV 162 MS+S EMR++++ T IVR+PTYGIVRG H+LPYICLG S+ G+ +++V G+V Sbjct: 1 MSISPEEMREIFQHTTIVRRPTYGIVRGYHELPYICLGASLESGYASTRVRGRV 54
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7C8ALZ3_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7C8ALZ3_9BACT) HSP 1 Score: 69.3 bits (168), Expect = 2.050e-13 Identity = 29/55 (52.73%), Postives = 42/55 (76.36%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M+LS+ EMR+++ T I+R+PTYGI+ G H+LPY+CLG S +T++V GKVH Sbjct: 1 MALSSDEMREIFERTEILRRPTYGIISGYHELPYVCLGASFEPDRQTTEVRGKVH 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7Y5F7H8_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7Y5F7H8_9BACT) HSP 1 Score: 65.1 bits (157), Expect = 8.860e-12 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 7 LSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 LS+ E+R+++R T IVRKPTYGI+ G H LPY+CLG S T++V GKVH Sbjct: 2 LSSDELREIFRRTQIVRKPTYGIISGYHTLPYVCLGVSEDKPFGTTQVKGKVH 54
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A1V5YZV4_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium ADurb.Bin170 TaxID=1852848 RepID=A0A1V5YZV4_9BACT) HSP 1 Score: 64.3 bits (155), Expect = 1.760e-11 Identity = 29/55 (52.73%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 MSLS EMR +Y T I+R+PTYGIV+G H+LPYICLG + + V G++H Sbjct: 1 MSLSFDEMRDIYNRTRIIRRPTYGIVKGYHELPYICLGAGLDGTRGSLYVRGRIH 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A1V5Z8D2_9BACT (Uncharacterized protein n=2 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A1V5Z8D2_9BACT) HSP 1 Score: 64.3 bits (155), Expect = 1.760e-11 Identity = 26/55 (47.27%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M LS EM+ ++ T+IVR+PT+GI++G H+LPYIC+G ++ T +V GK+H Sbjct: 1 MELSRREMKDIFDRTIIVRRPTHGIIKGYHELPYICVGNALDQQEGTMRVRGKIH 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7V2Y4E9_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7V2Y4E9_9BACT) HSP 1 Score: 64.3 bits (155), Expect = 1.790e-11 Identity = 26/55 (47.27%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M S HEM +++ T I+R+PTYGI+ G H+LPY+CLG + G T++V G+V+ Sbjct: 1 MPFSGHEMHEIFSRTEIIRRPTYGIISGYHELPYVCLGDACERGFATTEVRGRVY 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7C1CL18_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7C1CL18_9BACT) HSP 1 Score: 63.2 bits (152), Expect = 4.930e-11 Identity = 25/55 (45.45%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M+L MR +Y T+I+R PTYGI++G H+LPYICLG ++ + +V G++H Sbjct: 1 MALDKRAMRDIYERTIILRTPTYGIIKGYHELPYICLGEALESASGSMRVRGRIH 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7C3WZX8_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7C3WZX8_9BACT) HSP 1 Score: 61.2 bits (147), Expect = 1.790e-10 Identity = 25/55 (45.45%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M+L+ EM +++ TVI++KP YGI++G H+LPYICLG ++ + + V GK+H Sbjct: 1 MTLNREEMYRIFAETVIIKKPRYGIIKGYHELPYICLGEALESHYGSLCVRGKIH 55
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Match: A0A7C4Z0G1_9BACT (Uncharacterized protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A7C4Z0G1_9BACT) HSP 1 Score: 58.9 bits (141), Expect = 2.170e-9 Identity = 24/55 (43.64%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 1 MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVIGKVH 165 M+LS EM +++ T ++R+P YGIV+G H+LPYIC+G + + + V GK+H Sbjct: 1 MTLSREEMYRIFVETAVIRRPRYGIVKGYHELPYICIGNPLDSQYRSLCVRGKIH 55 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87583.20341.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig87583.20341.1 >prot_M-pyrifera_M_contig87583.20341.1 ID=prot_M-pyrifera_M_contig87583.20341.1|Name=mRNA_M-pyrifera_M_contig87583.20341.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bp MSLSAHEMRQLYRSTVIVRKPTYGIVRGSHDLPYICLGPSITDGHETSKVback to top mRNA from alignment at M-pyrifera_M_contig87583:667..831+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig87583.20341.1 ID=mRNA_M-pyrifera_M_contig87583.20341.1|Name=mRNA_M-pyrifera_M_contig87583.20341.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=165bp|location=Sequence derived from alignment at M-pyrifera_M_contig87583:667..831+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig87583:667..831+ >mRNA_M-pyrifera_M_contig87583.20341.1 ID=mRNA_M-pyrifera_M_contig87583.20341.1|Name=mRNA_M-pyrifera_M_contig87583.20341.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig87583:667..831+ (Macrocystis pyrifera P11B4 male)back to top |