mRNA_M-pyrifera_M_contig87501.20327.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: A0A5E5AEL4_9BURK (DUF4224 domain-containing protein n=2 Tax=Pandoraea anapnoica TaxID=2508301 RepID=A0A5E5AEL4_9BURK) HSP 1 Score: 54.7 bits (130), Expect = 1.260e-8 Identity = 25/45 (55.56%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 13 LHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVREH 147 + LT+SE+ E+TGRVR +Q+ LSA+GI KV PDG +LV+R H Sbjct: 8 IFLTQSEIREMTGRVRHKSQTLVLSALGIEHKVRPDGSLLVLRSH 52
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: UPI00096A95B1 (DUF4224 domain-containing protein n=1 Tax=Halomonas massiliensis TaxID=1816686 RepID=UPI00096A95B1) HSP 1 Score: 47.4 bits (111), Expect = 8.910e-6 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 13 LHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVREH 147 L LT EL ++TGR ++ +Q AL AMGI +K+N GK+LV R+H Sbjct: 4 LFLTAEELIQLTGRKQTKSQREALDAMGIYWKINAAGKLLVGRKH 48
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: UPI0018E09BE6 (DUF4224 domain-containing protein n=1 Tax=Halomonas elongata TaxID=2746 RepID=UPI0018E09BE6) HSP 1 Score: 46.2 bits (108), Expect = 2.550e-5 Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 1 Query: 13 LHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVREH 147 L LT EL E+TGR R QS L+AMGI +K N G+++V R H Sbjct: 3 LFLTSEELEELTGRKRRKEQSETLTAMGIRWKTNAAGELIVGRSH 47
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: A0A4S1E765_9BURK (DUF4224 domain-containing protein n=1 Tax=Alcaligenaceae bacterium 429 TaxID=2562948 RepID=A0A4S1E765_9BURK) HSP 1 Score: 46.2 bits (108), Expect = 3.450e-5 Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 13 LHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVR 141 L L + EL EITG+ R+ + L+ MGIPF++ PDG ++V++ Sbjct: 10 LTLNDPELTEITGKTRNKGRIEVLTQMGIPFRIRPDGSLVVLK 52
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: A0A537AZ45_9PROT (DUF4224 domain-containing protein (Fragment) n=1 Tax=Betaproteobacteria bacterium TaxID=1891241 RepID=A0A537AZ45_9PROT) HSP 1 Score: 47.0 bits (110), Expect = 3.960e-5 Identity = 22/46 (47.83%), Postives = 31/46 (67.39%), Query Frame = 1 Query: 7 GMLHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVRE 144 G L L+ +EL +T R R AQ R L A+GI +++ PDG I+V+RE Sbjct: 50 GALLLSPAELVALTERTRRGAQRRVLDALGISYRLRPDGSIVVLRE 95
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Match: A0A4V3G204_9GAMM (Uncharacterized protein DUF4224 n=1 Tax=Halomonas alkaliantarctica TaxID=232346 RepID=A0A4V3G204_9GAMM) HSP 1 Score: 45.1 bits (105), Expect = 7.270e-5 Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 13 LHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVREH 147 L LT E+ +TGR + +Q AL AMGI +KVN GK+LV R+H Sbjct: 4 LFLTVEEMVRLTGRKQYKSQREALDAMGIYWKVNAAGKLLVGRKH 48 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87501.20327.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig87501.20327.1 >prot_M-pyrifera_M_contig87501.20327.1 ID=prot_M-pyrifera_M_contig87501.20327.1|Name=mRNA_M-pyrifera_M_contig87501.20327.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bp MLHLTESELAEITGRVRSAAQSRALSAMGIPFKVNPDGKILVVREHback to top mRNA from alignment at M-pyrifera_M_contig87501:534..680+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig87501.20327.1 ID=mRNA_M-pyrifera_M_contig87501.20327.1|Name=mRNA_M-pyrifera_M_contig87501.20327.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=147bp|location=Sequence derived from alignment at M-pyrifera_M_contig87501:534..680+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig87501:534..680+ >mRNA_M-pyrifera_M_contig87501.20327.1 ID=mRNA_M-pyrifera_M_contig87501.20327.1|Name=mRNA_M-pyrifera_M_contig87501.20327.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=276bp|location=Sequence derived from alignment at M-pyrifera_M_contig87501:534..680+ (Macrocystis pyrifera P11B4 male)back to top |