mRNA_M-pyrifera_M_contig87070.20246.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87070.20246.1 vs. uniprot
Match: A0A6H5KBF2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBF2_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 2.270e-11 Identity = 30/36 (83.33%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 10 PGFVVHAEAALRWLGVEGLTPEVLRRAKRGLREEGV 117 PGFVVHAE +W+GVEGLTPEVLRRAKRGLREE V Sbjct: 238 PGFVVHAEEVFKWMGVEGLTPEVLRRAKRGLREEAV 273 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87070.20246.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig87070.20246.1 >prot_M-pyrifera_M_contig87070.20246.1 ID=prot_M-pyrifera_M_contig87070.20246.1|Name=mRNA_M-pyrifera_M_contig87070.20246.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=39bp PQPPGFVVHAEAALRWLGVEGLTPEVLRRAKRGLREEGVback to top mRNA from alignment at M-pyrifera_M_contig87070:615..731- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig87070.20246.1 ID=mRNA_M-pyrifera_M_contig87070.20246.1|Name=mRNA_M-pyrifera_M_contig87070.20246.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=117bp|location=Sequence derived from alignment at M-pyrifera_M_contig87070:615..731- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig87070:615..731- >mRNA_M-pyrifera_M_contig87070.20246.1 ID=mRNA_M-pyrifera_M_contig87070.20246.1|Name=mRNA_M-pyrifera_M_contig87070.20246.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig87070:615..731- (Macrocystis pyrifera P11B4 male)back to top |