mRNA_M-pyrifera_M_contig86840.20198.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86840.20198.1 vs. uniprot
Match: A0A0D2WM03_CAPO3 (Uncharacterized protein n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WM03_CAPO3) HSP 1 Score: 64.7 bits (156), Expect = 1.360e-9 Identity = 42/137 (30.66%), Postives = 63/137 (45.99%), Query Frame = 1 Query: 1 FNLEWSPGGDFLIASLESGVVVVLDTFHPDGLHRVCRFMAHENGTNVMSFDSEGRLFTGGVDGVARMWDFSKLCAARGDLESEE----------GGGITQFGLLREFVGHEDDVKNVCPLGSSILLTCSFDGTLRAW 381 +NLE++PGG+ L+A+ +G ++LD + RV E G NV+ F +E TGG D ++WD K C + +E + + L+E GH VKNV L+T D T+R W Sbjct: 161 YNLEFTPGGECLVATASNGAFLLLDPRTYSEVGRVSNAHGGE-GVNVVRFLNERVFATGGDDFSVKLWDLRKCCRSTSSQPNEARFVQTATTPAASLMDRVTPLQELRGHHGWVKNVEIARDGRLVTAGMDNTIRLW 296 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86840.20198.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86840.20198.1 >prot_M-pyrifera_M_contig86840.20198.1 ID=prot_M-pyrifera_M_contig86840.20198.1|Name=mRNA_M-pyrifera_M_contig86840.20198.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=127bp FNLEWSPGGDFLIASLESGVVVVLDTFHPDGLHRVCRFMAHENGTNVMSFback to top mRNA from alignment at M-pyrifera_M_contig86840:145..525+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86840.20198.1 ID=mRNA_M-pyrifera_M_contig86840.20198.1|Name=mRNA_M-pyrifera_M_contig86840.20198.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=381bp|location=Sequence derived from alignment at M-pyrifera_M_contig86840:145..525+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86840:145..525+ >mRNA_M-pyrifera_M_contig86840.20198.1 ID=mRNA_M-pyrifera_M_contig86840.20198.1|Name=mRNA_M-pyrifera_M_contig86840.20198.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=762bp|location=Sequence derived from alignment at M-pyrifera_M_contig86840:145..525+ (Macrocystis pyrifera P11B4 male)back to top |