mRNA_M-pyrifera_M_contig8667.20160.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Match: A0A6H5JH29_9PHAE (Ubiquitin-like domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH29_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 8.610e-16 Identity = 36/52 (69.23%), Postives = 43/52 (82.69%), Query Frame = 1 Query: 16 EGRMTVRILDVKGQIYKLVVRPETTVHELKTRLVEEAGVEIARQRIIYGGKV 171 +GRMTVR+LDV+GQ Y L V PET+V ELK LV+ AGVE+ RQRII+GGKV Sbjct: 80 DGRMTVRVLDVRGQFYPLRVTPETSVRELKLMLVDAAGVEVPRQRIIHGGKV 131
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Match: D8LJ71_ECTSI (Ubiquitin-like domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ71_ECTSI) HSP 1 Score: 73.9 bits (180), Expect = 4.950e-14 Identity = 35/52 (67.31%), Postives = 43/52 (82.69%), Query Frame = 1 Query: 16 EGRMTVRILDVKGQIYKLVVRPETTVHELKTRLVEEAGVEIARQRIIYGGKV 171 +GRMTVR+LDV+GQ Y L V PET+V ELK LV+ AGVE+ RQRII+GGK+ Sbjct: 81 DGRMTVRVLDVRGQFYPLRVTPETSVRELKLMLVDAAGVEVPRQRIIHGGKM 132 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8667.20160.1 >prot_M-pyrifera_M_contig8667.20160.1 ID=prot_M-pyrifera_M_contig8667.20160.1|Name=mRNA_M-pyrifera_M_contig8667.20160.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bp MTVRILDVKGQIYKLVVRPETTVHELKTRLVEEAGVEIARQRIIYGGKVback to top mRNA from alignment at M-pyrifera_M_contig8667:10846..11016+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8667.20160.1 ID=mRNA_M-pyrifera_M_contig8667.20160.1|Name=mRNA_M-pyrifera_M_contig8667.20160.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig8667:10846..11016+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8667:10846..11016+ >mRNA_M-pyrifera_M_contig8667.20160.1 ID=mRNA_M-pyrifera_M_contig8667.20160.1|Name=mRNA_M-pyrifera_M_contig8667.20160.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig8667:10846..11016+ (Macrocystis pyrifera P11B4 male)back to top |