mRNA_M-pyrifera_M_contig86651.20158.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86651.20158.1 vs. uniprot
Match: A0A2T9YT82_9FUNG (Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YT82_9FUNG) HSP 1 Score: 49.3 bits (116), Expect = 4.650e-5 Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 1 Query: 1 MVAEKYKKCCPCCGKEVPETLKHIMLRCRRWKKGREEMLGSMIREANKLT 150 ++++ YKK CPCC PET++HI+L C RW R E + I KLT Sbjct: 601 LISKLYKKKCPCCNANFPETIEHILLGCSRWAAIRAETIRKFIPRLYKLT 650 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86651.20158.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86651.20158.1 >prot_M-pyrifera_M_contig86651.20158.1 ID=prot_M-pyrifera_M_contig86651.20158.1|Name=mRNA_M-pyrifera_M_contig86651.20158.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=71bp MVAEKYKKCCPCCGKEVPETLKHIMLRCRRWKKGREEMLGSMIREANKLTback to top mRNA from alignment at M-pyrifera_M_contig86651:328..540+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86651.20158.1 ID=mRNA_M-pyrifera_M_contig86651.20158.1|Name=mRNA_M-pyrifera_M_contig86651.20158.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=213bp|location=Sequence derived from alignment at M-pyrifera_M_contig86651:328..540+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86651:328..540+ >mRNA_M-pyrifera_M_contig86651.20158.1 ID=mRNA_M-pyrifera_M_contig86651.20158.1|Name=mRNA_M-pyrifera_M_contig86651.20158.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=426bp|location=Sequence derived from alignment at M-pyrifera_M_contig86651:328..540+ (Macrocystis pyrifera P11B4 male)back to top |