mRNA_M-pyrifera_M_contig86064.20060.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86064.20060.1 vs. uniprot
Match: A0A2G9H4R2_9LAMI (E3 ubiquitin-protein ligase RNF170 n=1 Tax=Handroanthus impetiginosus TaxID=429701 RepID=A0A2G9H4R2_9LAMI) HSP 1 Score: 50.4 bits (119), Expect = 4.860e-5 Identity = 38/105 (36.19%), Postives = 58/105 (55.24%), Query Frame = 1 Query: 28 LTFVDQYNAVCGG-GGGVGAVATEAPWLLSRLFHDPTGI-RSIVCSSYAFFFLAPIVSSLAYAFLPVDLIPDASLPFLGFIDDIIVIIVALVIMAGVYRAWVVEQ 336 L + +YN + G G+ + P+LL RL D RS+ +LA I S+L Y PVD+IP+A L LGF+DD+I+I + + +A +YRA +V + Sbjct: 78 LQGIQRYNRLYGERSNGLFQRMQDLPFLLKRLLRDIMDPQRSLPLVLRTRVYLAVIGSAL-YVISPVDIIPEALLGILGFVDDLIIIFICFLHVAALYRAVLVSR 181 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86064.20060.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86064.20060.1 >prot_M-pyrifera_M_contig86064.20060.1 ID=prot_M-pyrifera_M_contig86064.20060.1|Name=mRNA_M-pyrifera_M_contig86064.20060.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bp SSPSPAPSTLTFVDQYNAVCGGGGGVGAVATEAPWLLSRLFHDPTGIRSIback to top mRNA from alignment at M-pyrifera_M_contig86064:475..837- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86064.20060.1 ID=mRNA_M-pyrifera_M_contig86064.20060.1|Name=mRNA_M-pyrifera_M_contig86064.20060.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=363bp|location=Sequence derived from alignment at M-pyrifera_M_contig86064:475..837- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86064:475..837- >mRNA_M-pyrifera_M_contig86064.20060.1 ID=mRNA_M-pyrifera_M_contig86064.20060.1|Name=mRNA_M-pyrifera_M_contig86064.20060.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=726bp|location=Sequence derived from alignment at M-pyrifera_M_contig86064:475..837- (Macrocystis pyrifera P11B4 male)back to top |