mRNA_M-pyrifera_M_contig85164.19848.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85164.19848.1 vs. uniprot
Match: A0A5A8E603_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8E603_CAFRO) HSP 1 Score: 97.1 bits (240), Expect = 7.920e-22 Identity = 45/72 (62.50%), Postives = 57/72 (79.17%), Query Frame = 1 Query: 4 RRERCEHVMHILTKELANEVRRIKDLHACPPHQVSALRWKAARERAEAGDWIMRILADYKMISATVMADYLR 219 +R+RCEH + IL +E+A EV+R L ACP ++ LRW+ ARERAEAGDWIMRIL DY+++SATVM DYLR Sbjct: 4 KRQRCEHALAILQEEVAKEVQRQSSLAACPAGRLGRLRWQVARERAEAGDWIMRILQDYRLVSATVMVDYLR 75
BLAST of mRNA_M-pyrifera_M_contig85164.19848.1 vs. uniprot
Match: A0A5A8C4A1_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8C4A1_CAFRO) HSP 1 Score: 97.1 bits (240), Expect = 8.230e-22 Identity = 45/72 (62.50%), Postives = 57/72 (79.17%), Query Frame = 1 Query: 4 RRERCEHVMHILTKELANEVRRIKDLHACPPHQVSALRWKAARERAEAGDWIMRILADYKMISATVMADYLR 219 +R+RCEH + IL +E+A EV+R L ACP ++ LRW+ ARERAEAGDWIMRIL DY+++SATVM DYLR Sbjct: 236 KRQRCEHALAILQEEVAKEVQRQSSLAACPAGRLGRLRWQVARERAEAGDWIMRILQDYRLVSATVMVDYLR 307
BLAST of mRNA_M-pyrifera_M_contig85164.19848.1 vs. uniprot
Match: A0A2R5GH53_9STRA (Uncharacterized protein n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GH53_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 7.060e-10 Identity = 32/73 (43.84%), Postives = 49/73 (67.12%), Query Frame = 1 Query: 1 HRRERCEHVMHILTKELANEVRRIKDLHACPP-HQVSALRWKAARERAEAGDWIMRILADYKMISATVMADYL 216 HR R EH+++++ +E ++RR DL AC ++ L W+ AR+R EA D +MR+L DYK+ISAT + +YL Sbjct: 205 HRLRRLEHLLYLVQEEQRKDMRREIDLCACDDTRELRNLVWETARDRTEAADMLMRLLDDYKLISATEIGEYL 277 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85164.19848.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85164.19848.1 >prot_M-pyrifera_M_contig85164.19848.1 ID=prot_M-pyrifera_M_contig85164.19848.1|Name=mRNA_M-pyrifera_M_contig85164.19848.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bp MHILTKELANEVRRIKDLHACPPHQVSALRWKAARERAEAGDWIMRILADback to top mRNA from alignment at M-pyrifera_M_contig85164:4..225+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85164.19848.1 ID=mRNA_M-pyrifera_M_contig85164.19848.1|Name=mRNA_M-pyrifera_M_contig85164.19848.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=222bp|location=Sequence derived from alignment at M-pyrifera_M_contig85164:4..225+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85164:4..225+ >mRNA_M-pyrifera_M_contig85164.19848.1 ID=mRNA_M-pyrifera_M_contig85164.19848.1|Name=mRNA_M-pyrifera_M_contig85164.19848.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=390bp|location=Sequence derived from alignment at M-pyrifera_M_contig85164:4..225+ (Macrocystis pyrifera P11B4 male)back to top |