mRNA_M-pyrifera_M_contig85006.19812.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Match: D7FJE6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FJE6_ECTSI) HSP 1 Score: 82.0 bits (201), Expect = 1.940e-16 Identity = 39/58 (67.24%), Postives = 49/58 (84.48%), Query Frame = 1 Query: 1 GMTLEEYDEMKQQRKPSDRNPDVSLETRLKISARLKEKWKDPTYRERRKGCMPNRQGI 174 GMTLEEY+EMK+++ R+P V+ ETR KISARLK KW+DP+YRERRK CMPNR+G+ Sbjct: 88 GMTLEEYEEMKRRKPAGKRDPTVTEETRKKISARLKAKWQDPSYRERRKQCMPNRKGV 145
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Match: A0A836CNQ5_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNQ5_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 1.520e-7 Identity = 32/64 (50.00%), Postives = 41/64 (64.06%), Query Frame = 1 Query: 1 GMTLEEYDEMKQQRKPSDRNPD---VSLETRLKISARLKEKWKDPTYRERRKGCMPNRQGIAHS 183 GMT+EEYD K++ D +S ET+ KISARLKEKWKDP +R+ R +P R+G HS Sbjct: 193 GMTVEEYDASKRRTPKRDTKGGQVKLSEETKAKISARLKEKWKDPAFRKERLANIPTRKGRGHS 256 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85006.19812.1 >prot_M-pyrifera_M_contig85006.19812.1 ID=prot_M-pyrifera_M_contig85006.19812.1|Name=mRNA_M-pyrifera_M_contig85006.19812.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=84bp MTLEEYDEMKQQRKPSDRNPDVSLETRLKISARLKEKWKDPTYRERRKGCback to top mRNA from alignment at M-pyrifera_M_contig85006:378..632- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85006.19812.1 ID=mRNA_M-pyrifera_M_contig85006.19812.1|Name=mRNA_M-pyrifera_M_contig85006.19812.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=255bp|location=Sequence derived from alignment at M-pyrifera_M_contig85006:378..632- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85006:378..632- >mRNA_M-pyrifera_M_contig85006.19812.1 ID=mRNA_M-pyrifera_M_contig85006.19812.1|Name=mRNA_M-pyrifera_M_contig85006.19812.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=504bp|location=Sequence derived from alignment at M-pyrifera_M_contig85006:378..632- (Macrocystis pyrifera P11B4 male)back to top |