mRNA_M-pyrifera_M_contig84825.19763.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84825.19763.1 vs. uniprot
Match: UPI0018AEC40B (exocyst complex component EXO70B1 n=1 Tax=Dioscorea cayennensis subsp. rotundata TaxID=55577 RepID=UPI0018AEC40B) HSP 1 Score: 54.7 bits (130), Expect = 1.970e-6 Identity = 29/91 (31.87%), Postives = 50/91 (54.95%), Query Frame = 1 Query: 34 SMRAKIQAFNAAVEDVYSEQQQYHVPDKELKKKITADIALSLLPIYENFAQRWEVAMAQKQKYEHLLKYSPSTLAKMIDRLFDGSAGVSSP 306 +MR +++ FN +EDV+SEQ+ + VPD+ L++++ ++P YE F R V + + LL +S + I LF GS+ + P Sbjct: 497 AMRERLRLFNGYLEDVWSEQRGWVVPDERLRQELREASVGMVVPAYEGFLGRLRVVEGGRGVEKQLLMFSVEDVETRIGDLFQGSSSIRRP 587
BLAST of mRNA_M-pyrifera_M_contig84825.19763.1 vs. uniprot
Match: A0A7N2N2Q9_QUELO (Exocyst subunit Exo70 family protein n=4 Tax=Fagaceae TaxID=3503 RepID=A0A7N2N2Q9_QUELO) HSP 1 Score: 54.3 bits (129), Expect = 2.730e-6 Identity = 26/92 (28.26%), Postives = 52/92 (56.52%), Query Frame = 1 Query: 19 AKVRASMRAKIQAFNAAVEDVYSEQQQYHVPDKELKKKITADIALSLLPIYENFAQRWEVAMAQKQKYEHLLKYSPSTLAKMIDRLFDGSAG 294 A R ++ +++AFN A +++Y++Q + V DK+L++K + +++P+Y ++ Q + + Q +KY+ TL KM+ LF G Sbjct: 555 ATARDLVKKRLKAFNEAFDEMYTQQSNWVVSDKDLREKTCQVVVQAVVPVYRSYMQNYGPLVEQDASSSKYVKYTVQTLEKMLMSLFHPKPG 646
BLAST of mRNA_M-pyrifera_M_contig84825.19763.1 vs. uniprot
Match: A0A7S4HS38_9EUKA (Exocyst subunit Exo70 family protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HS38_9EUKA) HSP 1 Score: 50.8 bits (120), Expect = 6.470e-6 Identity = 30/84 (35.71%), Postives = 45/84 (53.57%), Query Frame = 1 Query: 4 KGKDDAKVRASMRAKIQAFNAAVEDVYSEQQQYHVPDKELKKKITADIALSLLPIYENFAQRWEVAMAQKQKYEHLLKYSPSTL 255 KGK D ++ +IQ+FN E ++ QQQY +P+KELK++I +++ L P YE F R V L+KY P + Sbjct: 32 KGKSD----KHLKQQIQSFNQEFEQMFRNQQQYVIPNKELKEQIVSELKAVLEPCYEAFYAR--VKQTSLSSDNSLMKYPPKVM 109 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84825.19763.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84825.19763.1 >prot_M-pyrifera_M_contig84825.19763.1 ID=prot_M-pyrifera_M_contig84825.19763.1|Name=mRNA_M-pyrifera_M_contig84825.19763.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bp GKGKDDAKVRASMRAKIQAFNAAVEDVYSEQQQYHVPDKELKKKITADIAback to top mRNA from alignment at M-pyrifera_M_contig84825:10..321+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84825.19763.1 ID=mRNA_M-pyrifera_M_contig84825.19763.1|Name=mRNA_M-pyrifera_M_contig84825.19763.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=312bp|location=Sequence derived from alignment at M-pyrifera_M_contig84825:10..321+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84825:10..321+ >mRNA_M-pyrifera_M_contig84825.19763.1 ID=mRNA_M-pyrifera_M_contig84825.19763.1|Name=mRNA_M-pyrifera_M_contig84825.19763.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=624bp|location=Sequence derived from alignment at M-pyrifera_M_contig84825:10..321+ (Macrocystis pyrifera P11B4 male)back to top |