mRNA_M-pyrifera_M_contig84467.19693.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A6H5LFY0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LFY0_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 2.200e-19 Identity = 38/44 (86.36%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 4 WEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKV 135 W AGEQ+FISYGPRSNDHLLQRYGFVE NPNDVYRITGL+DK+ Sbjct: 366 WTAGEQVFISYGPRSNDHLLQRYGFVEQDNPNDVYRITGLIDKL 409
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: D7G028_ECTSI (Rubis-subs-bind domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G028_ECTSI) HSP 1 Score: 84.7 bits (208), Expect = 7.240e-19 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 4 WEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKV 135 W AGEQ+ ISYGPRSNDHLL+RYGFVE NPNDVYRITGL+DK+ Sbjct: 46 WTAGEQVLISYGPRSNDHLLRRYGFVEQDNPNDVYRITGLIDKL 89
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A7S2E8C9_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S2E8C9_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 5.580e-10 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 19 QMFISYGPRSNDHLLQRYGFVEPSNPNDVY 108 Q+FISYGPRSND LLQ YGFVEP+NPND+Y Sbjct: 101 QLFISYGPRSNDQLLQYYGFVEPNNPNDIY 130
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A7S3AC26_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3AC26_9RHOD) HSP 1 Score: 60.1 bits (144), Expect = 8.030e-10 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 WEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKV 135 ++ GEQ+FISYG RSND LLQ YGFVE +NP+DVY + L V Sbjct: 50 YKKGEQVFISYGDRSNDQLLQYYGFVEENNPHDVYVVGETLQSV 93
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A8J4FZN4_9CHLO (SET domain-containing protein n=1 Tax=Volvox reticuliferus TaxID=1737510 RepID=A0A8J4FZN4_9CHLO) HSP 1 Score: 60.5 bits (145), Expect = 1.740e-9 Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 4 WEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLL 126 ++ GEQ+FISYGP+SND L+Q YGF E +NP+DVY +T +L Sbjct: 336 FKKGEQVFISYGPQSNDSLMQYYGFAEANNPHDVYVMTDML 376
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A7S3EP57_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3EP57_9RHOD) HSP 1 Score: 60.1 bits (144), Expect = 2.380e-9 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 4 WEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKV 135 ++ GEQ+FISYG RSND LLQ YGFVE +NP+DVY + L V Sbjct: 305 YKKGEQVFISYGDRSNDQLLQYYGFVEENNPHDVYVVGETLQSV 348
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A8J4F2B9_9CHLO (SET domain-containing protein n=2 Tax=Volvox africanus TaxID=51714 RepID=A0A8J4F2B9_9CHLO) HSP 1 Score: 59.7 bits (143), Expect = 3.260e-9 Identity = 25/38 (65.79%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 13 GEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLL 126 GEQ+FISYGP+SND L+Q YGF E +NP DVY +T +L Sbjct: 336 GEQVFISYGPQSNDSLMQYYGFAEANNPQDVYVMTDML 373
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A7S3FBI2_9VIRI (Hypothetical protein (Fragment) n=1 Tax=Prasinoderma singulare TaxID=676789 RepID=A0A7S3FBI2_9VIRI) HSP 1 Score: 57.0 bits (136), Expect = 4.290e-9 Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 7 EAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKV 135 E GE++FISYGP SND LL RYG+VE N DV+ LLD V Sbjct: 35 EVGEEVFISYGPLSNDALLLRYGYVESGNACDVFEFESLLDAV 77
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: A0A7S1MVV5_HEMAN (Hypothetical protein (Fragment) n=2 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A7S1MVV5_HEMAN) HSP 1 Score: 59.3 bits (142), Expect = 4.430e-9 Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 1 AWEAGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGL 123 A+ +Q++ISYG RSND LLQ YGFVE NPNDVY+IT + Sbjct: 338 AYGRDKQVYISYGSRSNDQLLQYYGFVEKDNPNDVYQITDI 378
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Match: B7G3N0_PHATC (Predicted protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7G3N0_PHATC) HSP 1 Score: 59.3 bits (142), Expect = 4.460e-9 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 10 AGEQMFISYGPRSNDHLLQRYGFVEPSNPNDVY 108 +G++++ISYGPRSND LLQ YGFVE +NPNDVY Sbjct: 373 SGDEVYISYGPRSNDQLLQYYGFVERNNPNDVY 405 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84467.19693.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84467.19693.1 >prot_M-pyrifera_M_contig84467.19693.1 ID=prot_M-pyrifera_M_contig84467.19693.1|Name=mRNA_M-pyrifera_M_contig84467.19693.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bp MFISYGPRSNDHLLQRYGFVEPSNPNDVYRITGLLDKVback to top mRNA from alignment at M-pyrifera_M_contig84467:334..468- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84467.19693.1 ID=mRNA_M-pyrifera_M_contig84467.19693.1|Name=mRNA_M-pyrifera_M_contig84467.19693.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=135bp|location=Sequence derived from alignment at M-pyrifera_M_contig84467:334..468- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84467:334..468- >mRNA_M-pyrifera_M_contig84467.19693.1 ID=mRNA_M-pyrifera_M_contig84467.19693.1|Name=mRNA_M-pyrifera_M_contig84467.19693.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig84467:334..468- (Macrocystis pyrifera P11B4 male)back to top |