mRNA_M-pyrifera_M_contig8351.19509.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8351.19509.1 vs. uniprot
Match: D8LH82_ECTSI (HAD-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LH82_ECTSI) HSP 1 Score: 96.3 bits (238), Expect = 1.440e-22 Identity = 44/69 (63.77%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 1 ISAATRVAYRDMLFFDDDELNVKTVSEVGACCFRVSKDSGLTFVAVRSGFKKYREICLSRSSMRAWLQP 207 I AAT V YRDMLFFDD++ N+KTV +G C +VSK+SGLTF AV +G K+YRE CLSRSS+R W P Sbjct: 190 IHAATGVEYRDMLFFDDEKHNIKTVRRLGVTCIKVSKESGLTFAAVNAGLKEYREACLSRSSLRGWFTP 258
BLAST of mRNA_M-pyrifera_M_contig8351.19509.1 vs. uniprot
Match: A0A6H5KSC5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSC5_9PHAE) HSP 1 Score: 95.9 bits (237), Expect = 1.990e-22 Identity = 44/69 (63.77%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 1 ISAATRVAYRDMLFFDDDELNVKTVSEVGACCFRVSKDSGLTFVAVRSGFKKYREICLSRSSMRAWLQP 207 I AAT V YR+MLFFDD++ N+KTV +G C +VSK+SGLTF AV +G KKYRE CLSRSS+R W P Sbjct: 189 IHAATGVEYREMLFFDDEKHNIKTVRRLGVTCVKVSKESGLTFAAVNAGLKKYREACLSRSSLRGWFTP 257
BLAST of mRNA_M-pyrifera_M_contig8351.19509.1 vs. uniprot
Match: A0A8J1URT8_OWEFU (Ofus.G181091 protein n=1 Tax=Owenia fusiformis TaxID=6347 RepID=A0A8J1URT8_OWEFU) HSP 1 Score: 48.9 bits (115), Expect = 3.610e-5 Identity = 21/58 (36.21%), Postives = 39/58 (67.24%), Query Frame = 1 Query: 19 VAYRDMLFFDDDELNVKTVSEVGACCFRVSKDSGLTFVAVRSGFKKYREICLSRSSMR 192 +AYRDMLFFDD+ N+ +S++G C + ++G++F + +GFK++ + +SS + Sbjct: 139 IAYRDMLFFDDEYRNIADISKLGVTC--IYTENGMSFPELTNGFKQFNDNQTKQSSTK 194 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8351.19509.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8351.19509.1 >prot_M-pyrifera_M_contig8351.19509.1 ID=prot_M-pyrifera_M_contig8351.19509.1|Name=mRNA_M-pyrifera_M_contig8351.19509.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=69bp ISAATRVAYRDMLFFDDDELNVKTVSEVGACCFRVSKDSGLTFVAVRSGFback to top mRNA from alignment at M-pyrifera_M_contig8351:364..570+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8351.19509.1 ID=mRNA_M-pyrifera_M_contig8351.19509.1|Name=mRNA_M-pyrifera_M_contig8351.19509.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=207bp|location=Sequence derived from alignment at M-pyrifera_M_contig8351:364..570+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8351:364..570+ >mRNA_M-pyrifera_M_contig8351.19509.1 ID=mRNA_M-pyrifera_M_contig8351.19509.1|Name=mRNA_M-pyrifera_M_contig8351.19509.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=414bp|location=Sequence derived from alignment at M-pyrifera_M_contig8351:364..570+ (Macrocystis pyrifera P11B4 male)back to top |