mRNA_M-pyrifera_M_contig82932.19376.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig82932.19376.1 vs. uniprot
Match: A0A2E8D5B2_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E8D5B2_9PLAN) HSP 1 Score: 61.2 bits (147), Expect = 6.810e-10 Identity = 28/38 (73.68%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 DELAEIAKHEGWVTSMAFSPDGATLATAGGSSLLYRPG 114 D+ +IAKHE WVTS+A+SPDGA LATAGG SL YRPG Sbjct: 29 DQADKIAKHERWVTSLAYSPDGAMLATAGGQSLQYRPG 66
BLAST of mRNA_M-pyrifera_M_contig82932.19376.1 vs. uniprot
Match: A0A3A0DSR5_9BACT (Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3A0DSR5_9BACT) HSP 1 Score: 53.9 bits (128), Expect = 2.600e-7 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 1 Query: 16 IAKHEGWVTSMAFSPDGATLATAGGSSLLYRPG 114 IA H WVT++AF+PDGATL T GG SLLYRPG Sbjct: 40 IATHARWVTAVAFTPDGATLVTTGGESLLYRPG 72 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig82932.19376.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig82932.19376.1 >prot_M-pyrifera_M_contig82932.19376.1 ID=prot_M-pyrifera_M_contig82932.19376.1|Name=mRNA_M-pyrifera_M_contig82932.19376.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bp DELAEIAKHEGWVTSMAFSPDGATLATAGGSSLLYRPGback to top mRNA from alignment at M-pyrifera_M_contig82932:790..903+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig82932.19376.1 ID=mRNA_M-pyrifera_M_contig82932.19376.1|Name=mRNA_M-pyrifera_M_contig82932.19376.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=114bp|location=Sequence derived from alignment at M-pyrifera_M_contig82932:790..903+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig82932:790..903+ >mRNA_M-pyrifera_M_contig82932.19376.1 ID=mRNA_M-pyrifera_M_contig82932.19376.1|Name=mRNA_M-pyrifera_M_contig82932.19376.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig82932:790..903+ (Macrocystis pyrifera P11B4 male)back to top |