mRNA_M-pyrifera_M_contig82739.19335.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig82739.19335.1 vs. uniprot
Match: UPI0006D1FD12 (IS5/IS1182 family transposase n=2 Tax=Nocardia arizonensis TaxID=1141647 RepID=UPI0006D1FD12) HSP 1 Score: 58.5 bits (140), Expect = 8.500e-8 Identity = 36/101 (35.64%), Postives = 50/101 (49.50%), Query Frame = 1 Query: 16 FSHKHQTNGLKVQTAVCHRGVLNKYIFHYSQPIKAAQHD-KSFYEATTLPELRLPGEVYLGDKGYAGATGVCSPFKGRDLNPTQKQYNRQLSAIHVKVEHA 315 +S KH+ +G+ VQ G I S + + HD K+ + L EL G + LGDKGY GA GV +P+KGR QK NR + + + E A Sbjct: 121 YSGKHRRHGMNVQVIASPEGG----IVWVSPALPGSVHDSKAAWIWRVLHELEQQGWIVLGDKGYQGAQGVLTPYKGRGKPAAQKNANRAHAQLRGRGERA 217 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig82739.19335.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig82739.19335.1 >prot_M-pyrifera_M_contig82739.19335.1 ID=prot_M-pyrifera_M_contig82739.19335.1|Name=mRNA_M-pyrifera_M_contig82739.19335.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=117bp MREGSFSHKHQTNGLKVQTAVCHRGVLNKYIFHYSQPIKAAQHDKSFYEAback to top mRNA from alignment at M-pyrifera_M_contig82739:366..716- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig82739.19335.1 ID=mRNA_M-pyrifera_M_contig82739.19335.1|Name=mRNA_M-pyrifera_M_contig82739.19335.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=351bp|location=Sequence derived from alignment at M-pyrifera_M_contig82739:366..716- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig82739:366..716- >mRNA_M-pyrifera_M_contig82739.19335.1 ID=mRNA_M-pyrifera_M_contig82739.19335.1|Name=mRNA_M-pyrifera_M_contig82739.19335.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=702bp|location=Sequence derived from alignment at M-pyrifera_M_contig82739:366..716- (Macrocystis pyrifera P11B4 male)back to top |