mRNA_M-pyrifera_M_contig821.19206.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig821.19206.1 vs. uniprot
Match: A0A1Q9F7G0_SYMMI (Pentatricopeptide repeat-containing protein, chloroplastic n=2 Tax=Symbiodinium TaxID=2949 RepID=A0A1Q9F7G0_SYMMI) HSP 1 Score: 48.1 bits (113), Expect = 6.760e-5 Identity = 21/53 (39.62%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 1 VIMSCEKSAQWEVALSLLREMSETGVQANSVSYNSCLAALAEAGEWERASALL 159 V+ +C + W++A+SLL++M+ T +Q + +S+N L A A A W+RA A+L Sbjct: 3067 VLQTCRRDGSWQMAVSLLQQMTWTSIQPDEISFNELLGAFAAAVSWQRALAVL 3119 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig821.19206.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig821.19206.1 >prot_M-pyrifera_M_contig821.19206.1 ID=prot_M-pyrifera_M_contig821.19206.1|Name=mRNA_M-pyrifera_M_contig821.19206.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bp MSCEKSAQWEVALSLLREMSETGVQANSVSYNSCLAALAEAGEWERASALback to top mRNA from alignment at M-pyrifera_M_contig821:14355..14525+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig821.19206.1 ID=mRNA_M-pyrifera_M_contig821.19206.1|Name=mRNA_M-pyrifera_M_contig821.19206.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig821:14355..14525+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig821:14355..14525+ >mRNA_M-pyrifera_M_contig821.19206.1 ID=mRNA_M-pyrifera_M_contig821.19206.1|Name=mRNA_M-pyrifera_M_contig821.19206.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig821:14355..14525+ (Macrocystis pyrifera P11B4 male)back to top |