mRNA_M-pyrifera_M_contig8206.19196.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8206.19196.1 vs. uniprot
Match: D7FNR2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNR2_ECTSI) HSP 1 Score: 65.9 bits (159), Expect = 7.560e-11 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 3 Query: 3 IPLKISGYVMYGFLEPTCIGRFIMRRSQEQNEGD 104 IPLKISGYVMYGFLEPTC+GRFIMRRSQE D Sbjct: 255 IPLKISGYVMYGFLEPTCVGRFIMRRSQEGRTSD 288 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8206.19196.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8206.19196.1 >prot_M-pyrifera_M_contig8206.19196.1 ID=prot_M-pyrifera_M_contig8206.19196.1|Name=mRNA_M-pyrifera_M_contig8206.19196.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bp MAFSSRLASGASSCDVARNRTRAMVRIDPHRWRKGSLLAAENTGSPLDLTback to top mRNA from alignment at M-pyrifera_M_contig8206:356..1416+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8206.19196.1 ID=mRNA_M-pyrifera_M_contig8206.19196.1|Name=mRNA_M-pyrifera_M_contig8206.19196.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=1061bp|location=Sequence derived from alignment at M-pyrifera_M_contig8206:356..1416+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8206:356..1416+ >mRNA_M-pyrifera_M_contig8206.19196.1 ID=mRNA_M-pyrifera_M_contig8206.19196.1|Name=mRNA_M-pyrifera_M_contig8206.19196.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=444bp|location=Sequence derived from alignment at M-pyrifera_M_contig8206:356..1416+ (Macrocystis pyrifera P11B4 male)back to top |