mRNA_M-pyrifera_M_contig81807.19147.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81807.19147.1 vs. uniprot
Match: A0A2D5B0G5_9BACT (Biotin carboxyl carrier protein of acetyl-CoA carboxylase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5B0G5_9BACT) HSP 1 Score: 81.6 bits (200), Expect = 4.270e-17 Identity = 39/71 (54.93%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 55 LTSPEVGTFTGAKPAGAIVQPGEVVGVIERLGVRFELVVPAGVSGRVANTPPARTHAPTAYGQELYHLEPV 267 L +PEVGTFT GA++ PG GV+ RL V FEL+VPAGV+GR+ + PP R HAP YG LY L P+ Sbjct: 18 LRAPEVGTFTCVVEEGAVLTPGSRAGVLHRLDVAFELIVPAGVTGRIVSIPPERVHAPVEYGAALYELAPL 88
BLAST of mRNA_M-pyrifera_M_contig81807.19147.1 vs. uniprot
Match: A0A521KG07_9BACT (Lipoyl-binding domain-containing protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A521KG07_9BACT) HSP 1 Score: 67.4 bits (163), Expect = 1.330e-11 Identity = 36/76 (47.37%), Postives = 44/76 (57.89%), Query Frame = 1 Query: 55 LTSPEVGTFTGAKPAGAIVQPGEVVGVIERLGVRFELVVPAGVSGRVANTPPARTHAPTAYGQELYHLEPVGDVSA 282 L +P G +T G ++Q GEV G + LG ELVVPAGV GRV PP R AP AYG L L P+ D++A Sbjct: 19 LLAPSPGAYTRGPAQGRVLQAGEVAGALIALGRARELVVPAGVHGRVVGAPPERVLAPVAYGDVLVELAPLSDLAA 94
BLAST of mRNA_M-pyrifera_M_contig81807.19147.1 vs. uniprot
Match: A0A356KED5_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A356KED5_9BACT) HSP 1 Score: 53.5 bits (127), Expect = 5.270e-6 Identity = 33/70 (47.14%), Postives = 42/70 (60.00%), Query Frame = 1 Query: 52 RLTSPEVGTFTGAKPAGAIVQPGEVVGVIERLGVRFELVVPAGVSGRVANTPPARTHAPTAYGQELYHLE 261 RLTSPEVG AGA++ PG V ++ L ELVVPAGV+GRV + P A AP +G E+ L+ Sbjct: 523 RLTSPEVGIAVEQPRAGAVLVPGARVALLSTLYETVELVVPAGVAGRVLDPPSAP--APLGHGDEVLALQ 590 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81807.19147.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81807.19147.1 >prot_M-pyrifera_M_contig81807.19147.1 ID=prot_M-pyrifera_M_contig81807.19147.1|Name=mRNA_M-pyrifera_M_contig81807.19147.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=105bp MTQTLELLSAPDDQGGTRLTSPEVGTFTGAKPAGAIVQPGEVVGVIERLGback to top mRNA from alignment at M-pyrifera_M_contig81807:10..324- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81807.19147.1 ID=mRNA_M-pyrifera_M_contig81807.19147.1|Name=mRNA_M-pyrifera_M_contig81807.19147.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=315bp|location=Sequence derived from alignment at M-pyrifera_M_contig81807:10..324- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81807:10..324- >mRNA_M-pyrifera_M_contig81807.19147.1 ID=mRNA_M-pyrifera_M_contig81807.19147.1|Name=mRNA_M-pyrifera_M_contig81807.19147.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=630bp|location=Sequence derived from alignment at M-pyrifera_M_contig81807:10..324- (Macrocystis pyrifera P11B4 male)back to top |