mRNA_M-pyrifera_M_contig81556.19086.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81556.19086.1 vs. uniprot
Match: A0A0H4XER5_9DELT (Uncharacterized protein n=1 Tax=Myxococcus hansupus TaxID=1297742 RepID=A0A0H4XER5_9DELT) HSP 1 Score: 60.8 bits (146), Expect = 2.670e-9 Identity = 29/63 (46.03%), Postives = 36/63 (57.14%), Query Frame = 1 Query: 7 GYRDADGVVVIPPIYKFASKEFNEGLAYVVAKDRRGYIHPDGSWAFDAKFTYCDKFVNGRARV 195 G+ D G VIP IY F +G+A V R GY+HPDGSWA + +FT F +GRA V Sbjct: 236 GFIDRSGQQVIPAIYDAVMGGFFQGVAPVKQGTRFGYLHPDGSWALEPRFTMAQPFADGRAAV 298 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81556.19086.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81556.19086.1 >prot_M-pyrifera_M_contig81556.19086.1 ID=prot_M-pyrifera_M_contig81556.19086.1|Name=mRNA_M-pyrifera_M_contig81556.19086.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=67bp MQGYRDADGVVVIPPIYKFASKEFNEGLAYVVAKDRRGYIHPDGSWAFDAback to top mRNA from alignment at M-pyrifera_M_contig81556:348..548+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81556.19086.1 ID=mRNA_M-pyrifera_M_contig81556.19086.1|Name=mRNA_M-pyrifera_M_contig81556.19086.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=201bp|location=Sequence derived from alignment at M-pyrifera_M_contig81556:348..548+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81556:348..548+ >mRNA_M-pyrifera_M_contig81556.19086.1 ID=mRNA_M-pyrifera_M_contig81556.19086.1|Name=mRNA_M-pyrifera_M_contig81556.19086.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=402bp|location=Sequence derived from alignment at M-pyrifera_M_contig81556:348..548+ (Macrocystis pyrifera P11B4 male)back to top |