mRNA_M-pyrifera_M_contig81489.19066.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81489.19066.1 vs. uniprot
Match: A0A847L4R5_9BACT (AraC family transcriptional regulator n=1 Tax=Bacteroidales bacterium TaxID=2030927 RepID=A0A847L4R5_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 2.920e-5 Identity = 29/112 (25.89%), Postives = 55/112 (49.11%), Query Frame = 1 Query: 40 IGLVLSVIMAIAFGLESKKRFANFWFTCFLIASAVVFIVKLLYSTGQIVNYPHWFKLNYPAGILRPVFFYLYIDFLLNGSTRIKTKYFLHFIPFALLSIYLLPFFQMDEAYK 375 +G+ LS+ +A + K ++ +++ A+ L+ G V YPH + +P +L YLY+ F L R + K ++HF+PF + ++++PFF + K Sbjct: 7 VGIFLSLFLATLLLTKRNKSLSDNILGAWMLVMAIHLSSYYLHYLGYWVKYPHLVGIAHPFPLLYGPLLYLYVVFSLRSDQRWRWKDWMHFLPFVVTYLFMIPFFSLSAEQK 118 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81489.19066.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81489.19066.1 >prot_M-pyrifera_M_contig81489.19066.1 ID=prot_M-pyrifera_M_contig81489.19066.1|Name=mRNA_M-pyrifera_M_contig81489.19066.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=133bp MDLRLNFNELLLLIGLVLSVIMAIAFGLESKKRFANFWFTCFLIASAVVFback to top mRNA from alignment at M-pyrifera_M_contig81489:183..581- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81489.19066.1 ID=mRNA_M-pyrifera_M_contig81489.19066.1|Name=mRNA_M-pyrifera_M_contig81489.19066.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=399bp|location=Sequence derived from alignment at M-pyrifera_M_contig81489:183..581- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81489:183..581- >mRNA_M-pyrifera_M_contig81489.19066.1 ID=mRNA_M-pyrifera_M_contig81489.19066.1|Name=mRNA_M-pyrifera_M_contig81489.19066.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=798bp|location=Sequence derived from alignment at M-pyrifera_M_contig81489:183..581- (Macrocystis pyrifera P11B4 male)back to top |