mRNA_M-pyrifera_M_contig8061.18871.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8061.18871.1 vs. uniprot
Match: D7G4C1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4C1_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 1.820e-14 Identity = 40/84 (47.62%), Postives = 52/84 (61.90%), Query Frame = 1 Query: 4 IKQLQLTCTSVCSDCRASSVFHVRVVSRTPRRLWTTARGPNRRRRSGKGAGVPGLPPLRVGRLTFGEYYNRAISAVALPSELTK 255 +KQLQL S+CS+ RA + FH+RVV RTP+RLWTT +GK G G+PP+RV LTF EY+ A+ V + L K Sbjct: 11 VKQLQLASLSICSESRACTAFHLRVVRRTPKRLWTTTSS------TGKRVGTDGVPPMRVDWLTFREYFEPAVRNVVWRAGLRK 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8061.18871.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8061.18871.1 >prot_M-pyrifera_M_contig8061.18871.1 ID=prot_M-pyrifera_M_contig8061.18871.1|Name=mRNA_M-pyrifera_M_contig8061.18871.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=162bp VIKQLQLTCTSVCSDCRASSVFHVRVVSRTPRRLWTTARGPNRRRRSGKGback to top mRNA from alignment at M-pyrifera_M_contig8061:5665..6150+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8061.18871.1 ID=mRNA_M-pyrifera_M_contig8061.18871.1|Name=mRNA_M-pyrifera_M_contig8061.18871.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=486bp|location=Sequence derived from alignment at M-pyrifera_M_contig8061:5665..6150+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8061:5665..6150+ >mRNA_M-pyrifera_M_contig8061.18871.1 ID=mRNA_M-pyrifera_M_contig8061.18871.1|Name=mRNA_M-pyrifera_M_contig8061.18871.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=972bp|location=Sequence derived from alignment at M-pyrifera_M_contig8061:5665..6150+ (Macrocystis pyrifera P11B4 male)back to top |