mRNA_M-pyrifera_M_contig79223.18596.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79223.18596.1 vs. uniprot
Match: A0A2H0WTB6_9BACT (Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium CG09_land_8_20_14_0_10_41_9 TaxID=1974850 RepID=A0A2H0WTB6_9BACT) HSP 1 Score: 61.6 bits (148), Expect = 2.300e-9 Identity = 33/90 (36.67%), Postives = 54/90 (60.00%), Query Frame = 1 Query: 1 VPNFVGHDIQ-LSYQKFLDRWFVDFDFSFIGK-----VLEIGSGYGQLALNLLPRANEYICLDLDTQSLVQILKQEKISGLVADKHKLPI 252 +P + G DI+ +Y KFL R+ + ++F ++ K +L+IGSG G+LAL L ++ C D+D +SL +I K++K+ L KL I Sbjct: 39 LPTYAGADIEEKNYMKFLKRFILTYEFGYLKKRQPMRILDIGSGSGELALQLSKFGHDVTCNDIDKKSLARISKRQKLKTLYGSIEKLSI 128 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79223.18596.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79223.18596.1 >prot_M-pyrifera_M_contig79223.18596.1 ID=prot_M-pyrifera_M_contig79223.18596.1|Name=mRNA_M-pyrifera_M_contig79223.18596.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=84bp VPNFVGHDIQLSYQKFLDRWFVDFDFSFIGKVLEIGSGYGQLALNLLPRAback to top mRNA from alignment at M-pyrifera_M_contig79223:84..962+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79223.18596.1 ID=mRNA_M-pyrifera_M_contig79223.18596.1|Name=mRNA_M-pyrifera_M_contig79223.18596.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=879bp|location=Sequence derived from alignment at M-pyrifera_M_contig79223:84..962+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79223:84..962+ >mRNA_M-pyrifera_M_contig79223.18596.1 ID=mRNA_M-pyrifera_M_contig79223.18596.1|Name=mRNA_M-pyrifera_M_contig79223.18596.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=504bp|location=Sequence derived from alignment at M-pyrifera_M_contig79223:84..962+ (Macrocystis pyrifera P11B4 male)back to top |