mRNA_M-pyrifera_M_contig78816.18516.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Match: D7FX52_ECTSI (Importin N-terminal domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX52_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 6.750e-13 Identity = 32/43 (74.42%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 4 LPHSLRQLLLQLSSVQGDVFDNDEEKKAYASFLVKGATAVLSS 132 LPH+LRQLLLQLSSV GD+F+ND+++KAYASFLV+GA AVL++ Sbjct: 288 LPHALRQLLLQLSSVHGDIFENDDQRKAYASFLVEGAAAVLAA 330
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Match: A0A6H5K5P3_9PHAE (Importin N-terminal domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5P3_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 6.750e-13 Identity = 32/43 (74.42%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 4 LPHSLRQLLLQLSSVQGDVFDNDEEKKAYASFLVKGATAVLSS 132 LPH+LRQLLLQLSSV GD+F+ND+++KAYASFLV+GA AVL++ Sbjct: 288 LPHALRQLLLQLSSVHGDIFENDDQRKAYASFLVEGAAAVLAA 330 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig78816.18516.1 >prot_M-pyrifera_M_contig78816.18516.1 ID=prot_M-pyrifera_M_contig78816.18516.1|Name=mRNA_M-pyrifera_M_contig78816.18516.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=44bp NLPHSLRQLLLQLSSVQGDVFDNDEEKKAYASFLVKGATAVLSSback to top mRNA from alignment at M-pyrifera_M_contig78816:336..467- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig78816.18516.1 ID=mRNA_M-pyrifera_M_contig78816.18516.1|Name=mRNA_M-pyrifera_M_contig78816.18516.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=132bp|location=Sequence derived from alignment at M-pyrifera_M_contig78816:336..467- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig78816:336..467- >mRNA_M-pyrifera_M_contig78816.18516.1 ID=mRNA_M-pyrifera_M_contig78816.18516.1|Name=mRNA_M-pyrifera_M_contig78816.18516.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=264bp|location=Sequence derived from alignment at M-pyrifera_M_contig78816:336..467- (Macrocystis pyrifera P11B4 male)back to top |