mRNA_M-pyrifera_M_contig75448.17799.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A1Y1I2K8_KLENI (Uncharacterized protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I2K8_KLENI) HSP 1 Score: 68.6 bits (166), Expect = 4.940e-12 Identity = 34/54 (62.96%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 10 LLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEIESM 171 LLA HN +FKAKPAYEPR HS+R + WE SGK Y +L+ ERE ANEEI M Sbjct: 549 LLAQHNRRFKAKPAYEPRMHSVRDTKQWEAVSGKTYYQLAPEEREAANEEITRM 602
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A329RJ34_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A329RJ34_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 2.740e-10 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 IEELLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEI 162 ++ELL HN KFKA YEP +HS+RQV+ WE+ +GK Y LS AER AN+EI Sbjct: 176 LQELLKKHNKKFKATHTYEPPQHSVRQVKQWERETGKSYYALSAAERVQANQEI 229
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A8J5XQL1_DIALT (Uncharacterized protein n=1 Tax=Diacronema lutheri TaxID=2081491 RepID=A0A8J5XQL1_DIALT) HSP 1 Score: 62.8 bits (151), Expect = 5.330e-10 Identity = 29/55 (52.73%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 7 ELLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEIESM 171 +LL HN+KF KPAYEPR+HS++ V+ WEK G++Y EL F R AN +I +M Sbjct: 415 DLLRQHNAKFAPKPAYEPRQHSVKAVKEWEKAHGRRYHELGFEARAEANRQIAAM 469
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A833WXK1_PHYIN (Uncharacterized protein n=1 Tax=Phytophthora infestans TaxID=4787 RepID=A0A833WXK1_PHYIN) HSP 1 Score: 57.0 bits (136), Expect = 3.920e-8 Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 1 IEELLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEI 162 + ELL HN KFKA YEP +HS+R+V+ WE+ +GK Y LS ER AN++I Sbjct: 179 LHELLKKHNKKFKAIHTYEPPQHSVREVKQWERDTGKSYYALSAEERVQANQDI 232
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: D8RLL5_SELML (Uncharacterized protein n=5 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8RLL5_SELML) HSP 1 Score: 53.1 bits (126), Expect = 1.330e-6 Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 10 LLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEI 162 L+A HNSKF KP YEPR HS R +R WE+ +G+ Y L ER N++I Sbjct: 373 LIAKHNSKFLLKPKYEPRLHSTRDIREWERRTGQLYYSLQPIERVKVNQDI 423
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A836CC55_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CC55_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.770e-6 Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 1 Query: 1 IEELLAAHN-SKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEIESMTKK 180 +E L++ HN S K K YEP +H+++ +AWE +GK+Y ELS +R AN I+ M ++ Sbjct: 4 LEALISKHNKSVMKGKATYEPSRHTLKDYKAWETKTGKRYHELSVDQRAEANTAIDDMKRQ 64
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A024GSS4_9STRA (Uncharacterized protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024GSS4_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 5.230e-6 Identity = 29/58 (50.00%), Postives = 36/58 (62.07%), Query Frame = 1 Query: 1 IEELLAAHNSKFK-AKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEIESM 171 +++LL HN K K YEPR HS+R VR WEK S KKY +LS + R AN EI + Sbjct: 185 LQQLLDKHNRGIKRTKHTYEPRHHSVRDVRLWEKHSKKKYYDLSPSSRVTANAEISKL 242
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A2K1IJF0_PHYPA (Uncharacterized protein n=1 Tax=Physcomitrium patens TaxID=3218 RepID=A0A2K1IJF0_PHYPA) HSP 1 Score: 50.8 bits (120), Expect = 8.810e-6 Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 10 LLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEI 162 L A HN KF+ K YEPR HS++ +R WE +G+ + L AERE AN EI Sbjct: 701 LQAEHNRKFRPKTKYEPRIHSVKDIREWEARTGQLFYNLPPAEREKANVEI 751
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Match: A0A2D4BT78_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BT78_PYTIN) HSP 1 Score: 49.7 bits (117), Expect = 1.540e-5 Identity = 28/60 (46.67%), Postives = 38/60 (63.33%), Query Frame = 1 Query: 1 IEELLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIANEEIESMTKK 180 ++ LLA HN KFK+ YEPR+HS+R VR + K Y LS ER ANEEI ++ ++ Sbjct: 147 LQALLAKHNKKFKSAHTYEPRQHSVRDVRT---QNNKSYYTLSSDERLQANEEIAALVRQ 203 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75448.17799.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75448.17799.1 >prot_M-pyrifera_M_contig75448.17799.1 ID=prot_M-pyrifera_M_contig75448.17799.1|Name=mRNA_M-pyrifera_M_contig75448.17799.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=61bp IEELLAAHNSKFKAKPAYEPRKHSIRQVRAWEKTSGKKYAELSFAEREIAback to top mRNA from alignment at M-pyrifera_M_contig75448:3..185+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75448.17799.1 ID=mRNA_M-pyrifera_M_contig75448.17799.1|Name=mRNA_M-pyrifera_M_contig75448.17799.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=183bp|location=Sequence derived from alignment at M-pyrifera_M_contig75448:3..185+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75448:3..185+ >mRNA_M-pyrifera_M_contig75448.17799.1 ID=mRNA_M-pyrifera_M_contig75448.17799.1|Name=mRNA_M-pyrifera_M_contig75448.17799.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=366bp|location=Sequence derived from alignment at M-pyrifera_M_contig75448:3..185+ (Macrocystis pyrifera P11B4 male)back to top |