mRNA_M-pyrifera_M_contig74848.17693.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Match: A0A507ESL2_9FUNG (YTH domain-containing protein n=1 Tax=Spizellomyces sp. 'palustris' TaxID=117820 RepID=A0A507ESL2_9FUNG) HSP 1 Score: 50.4 bits (119), Expect = 2.080e-5 Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1 Query: 37 PARYFVVKVPNEAMLRTCARRNAWGVERDIATKINHALRSCRAIFLFFSVVNSKGFQGVARL 222 P RYFV+ PN M++ NA+ I+TK++ A R+ R + LFF+V +S+ +QG AR+ Sbjct: 525 PIRYFVLISPNYDMIKQSQNINAFATIPAISTKLSEAYRNSRHVVLFFTVKDSRRWQGYARM 586
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Match: A0A1X7V720_AMPQE (YTH domain-containing protein n=4 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7V720_AMPQE) HSP 1 Score: 49.7 bits (117), Expect = 3.800e-5 Identity = 26/63 (41.27%), Postives = 32/63 (50.79%), Query Frame = 1 Query: 34 VPARYFVVKVPNEAMLRTCARRNAWGVERDIATKINHALRSCRAIFLFFSVVNSKGFQGVARL 222 V RYFV+K N + +N W K+N A R CR + L FSV S GFQG A+L Sbjct: 162 VNTRYFVIKSNNYENVDIAKSKNVWSTLPYNEKKLNKAYRDCRNVLLIFSVKESGGFQGFAKL 224 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74848.17693.1 >prot_M-pyrifera_M_contig74848.17693.1 ID=prot_M-pyrifera_M_contig74848.17693.1|Name=mRNA_M-pyrifera_M_contig74848.17693.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bp MVGAISEAVKLVPARYFVVKVPNEAMLRTCARRNAWGVERDIATKINHALback to top mRNA from alignment at M-pyrifera_M_contig74848:24..245- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74848.17693.1 ID=mRNA_M-pyrifera_M_contig74848.17693.1|Name=mRNA_M-pyrifera_M_contig74848.17693.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=222bp|location=Sequence derived from alignment at M-pyrifera_M_contig74848:24..245- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74848:24..245- >mRNA_M-pyrifera_M_contig74848.17693.1 ID=mRNA_M-pyrifera_M_contig74848.17693.1|Name=mRNA_M-pyrifera_M_contig74848.17693.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=444bp|location=Sequence derived from alignment at M-pyrifera_M_contig74848:24..245- (Macrocystis pyrifera P11B4 male)back to top |