mRNA_M-pyrifera_M_contig74572.17646.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A8H7T0I8_9FUNG (PDZ domain-containing protein n=1 Tax=Thamnidium elegans TaxID=101142 RepID=A0A8H7T0I8_9FUNG) HSP 1 Score: 55.5 bits (132), Expect = 1.800e-7 Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLR 207 FA+V+ V PD PAY+AG+RR D+I KFG L + L L + ++EN +PV +LR Sbjct: 128 FAIVNAVAPDSPAYSAGLRRNDRIIKFGHLDHSNHQRLQALNGFIGQSENQQVPVTILR 186
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A0D7A5H6_9AGAR (Uncharacterized protein n=1 Tax=Fistulina hepatica ATCC 64428 TaxID=1128425 RepID=A0A0D7A5H6_9AGAR) HSP 1 Score: 54.3 bits (129), Expect = 3.690e-7 Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 1 Query: 13 SEEVGVFALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTT--PFSLSDLASMVRENENSTIPVQVLR 207 +EE+ FA V+GV P PA AG++R D I KFG LT + SL LAS+V +NEN I V+VLR Sbjct: 91 AEELSPFARVNGVAPGSPAAEAGLQREDVIVKFGPLTKRSFGSESLQPLASLVSQNENRQIVVEVLR 157
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A8H7RIH8_9FUNG (Uncharacterized protein n=1 Tax=Mucor saturninus TaxID=64648 RepID=A0A8H7RIH8_9FUNG) HSP 1 Score: 54.3 bits (129), Expect = 4.770e-7 Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLR 207 FA+V+ V PD PAY+AG+RR D+I KFG + +L L +++ ++EN +PV +LR Sbjct: 126 FAIVNAVAPDSPAYSAGLRRNDRICKFGHIDEKNHQNLLALNALIGQSENIPVPVSLLR 184
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: UPI000867C3FB (uncharacterized protein n=1 Tax=Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) TaxID=698492 RepID=UPI000867C3FB) HSP 1 Score: 53.1 bits (126), Expect = 1.400e-6 Identity = 26/60 (43.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLRS 210 FALV+ V P+ PA +AG++RGD+I +FG++ + L+ LA +V+ NE +IP++V R+ Sbjct: 132 FALVNSVAPNSPAESAGLQRGDRIKRFGTVHAGNHAKLTKLAEVVQANEGRSIPLRVSRA 191
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A0E9NGL5_SAICN (Uncharacterized protein n=1 Tax=Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) TaxID=698492 RepID=A0A0E9NGL5_SAICN) HSP 1 Score: 53.1 bits (126), Expect = 2.150e-6 Identity = 26/60 (43.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLRS 210 FALV+ V P+ PA +AG++RGD+I +FG++ + L+ LA +V+ NE +IP++V R+ Sbjct: 132 FALVNSVAPNSPAESAGLQRGDRIKRFGTVHAGNHAKLTKLAEVVQANEGRSIPLRVSRA 191
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A1E3Q923_LIPST (Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q923_LIPST) HSP 1 Score: 50.8 bits (120), Expect = 6.100e-6 Identity = 28/59 (47.46%), Postives = 41/59 (69.49%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLR 207 FA+V+ V PA+ AG+ +GDKI KFGS+ + L+ LA++V+ENENS I + V+R Sbjct: 79 FAVVNTVVQRSPAHEAGLIKGDKIVKFGSVHAGNHQKLARLATVVQENENSPIEITVIR 137
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Match: A0A7R9TK10_9VIRI (Hypothetical protein n=1 Tax=Prasinoderma coloniale TaxID=156133 RepID=A0A7R9TK10_9VIRI) HSP 1 Score: 50.4 bits (119), Expect = 1.520e-5 Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 1 Query: 31 FALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDLASMVRENENSTIPVQVLRS 210 A+V V P GPA AG++RGD+I +FG+++ + L++LAS R NE + V+VLR+ Sbjct: 147 IAVVGDVAPGGPADEAGMKRGDRITRFGAISGSGGGGLAELASEARLNEGGAVGVRVLRT 206 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74572.17646.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74572.17646.1 >prot_M-pyrifera_M_contig74572.17646.1 ID=prot_M-pyrifera_M_contig74572.17646.1|Name=mRNA_M-pyrifera_M_contig74572.17646.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=73bp DGDGSEEVGVFALVDGVDPDGPAYAAGVRRGDKIHKFGSLTSTTPFSLSDback to top mRNA from alignment at M-pyrifera_M_contig74572:184..402+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74572.17646.1 ID=mRNA_M-pyrifera_M_contig74572.17646.1|Name=mRNA_M-pyrifera_M_contig74572.17646.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=219bp|location=Sequence derived from alignment at M-pyrifera_M_contig74572:184..402+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74572:184..402+ >mRNA_M-pyrifera_M_contig74572.17646.1 ID=mRNA_M-pyrifera_M_contig74572.17646.1|Name=mRNA_M-pyrifera_M_contig74572.17646.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=438bp|location=Sequence derived from alignment at M-pyrifera_M_contig74572:184..402+ (Macrocystis pyrifera P11B4 male)back to top |