mRNA_M-pyrifera_M_contig74485.17630.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: A0A501PNQ1_9PROT (NAD(P)H-dependent oxidoreductase n=1 Tax=Emcibacter nanhaiensis TaxID=1505037 RepID=A0A501PNQ1_9PROT) HSP 1 Score: 48.9 bits (115), Expect = 2.160e-5 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 7 VKIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLE 162 VKI+A AG++RKA+FNK ++K A A A AGAEV IDL LP+ N DLE Sbjct: 5 VKILAFAGSMRKASFNKSMVKAAAAGAEEAGAEVTYIDLRNYPLPLYNGDLE 56
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: A0A0W1LFZ8_9GAMM (FMN reductase n=6 Tax=Alteromonadales TaxID=135622 RepID=A0A0W1LFZ8_9GAMM) HSP 1 Score: 47.8 bits (112), Expect = 5.680e-5 Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 10 KIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLETK 168 KI+A+AG+LRK +FN+ ++ A A+ GAEVEVI L E ++P+ N+D+E + Sbjct: 5 KIIALAGSLRKESFNQKLINEAARFALQTGAEVEVIQLNELDIPLFNEDIEAQ 57
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: D2QY73_PIRSD (NADPH-dependent FMN reductase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2QY73_PIRSD) HSP 1 Score: 47.8 bits (112), Expect = 5.930e-5 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 13 IVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLE 162 I+A AG+LR+ ++NK ++K A A+AAGA VEVIDL E LPM ++D+E Sbjct: 7 ILAFAGSLRRDSYNKKLVKIAAEGAVAAGANVEVIDLTEYPLPMFDEDVE 56 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74485.17630.1 >prot_M-pyrifera_M_contig74485.17630.1 ID=prot_M-pyrifera_M_contig74485.17630.1|Name=mRNA_M-pyrifera_M_contig74485.17630.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bp MAVKIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNback to top mRNA from alignment at M-pyrifera_M_contig74485:876..1046+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74485.17630.1 ID=mRNA_M-pyrifera_M_contig74485.17630.1|Name=mRNA_M-pyrifera_M_contig74485.17630.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig74485:876..1046+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74485:876..1046+ >mRNA_M-pyrifera_M_contig74485.17630.1 ID=mRNA_M-pyrifera_M_contig74485.17630.1|Name=mRNA_M-pyrifera_M_contig74485.17630.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=342bp|location=Sequence derived from alignment at M-pyrifera_M_contig74485:876..1046+ (Macrocystis pyrifera P11B4 male)back to top |