mRNA_M-pyrifera_M_contig73982.17522.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73982.17522.1 vs. uniprot
Match: A0A8C3RTT4_CHESE (RING-type domain-containing protein n=1 Tax=Chelydra serpentina TaxID=8475 RepID=A0A8C3RTT4_CHESE) HSP 1 Score: 53.9 bits (128), Expect = 1.690e-5 Identity = 23/57 (40.35%), Postives = 33/57 (57.89%), Query Frame = 1 Query: 13 EDLRVKIHGTVSDDCPICLERMANISIIQPCLHFTCKSCMSKLS---GKCPMCRSLF 174 ED+ V G+ CPICLER+ N+S + PC H C C+ + S +CP+C+ F Sbjct: 23 EDVPVAAEGSSDSRCPICLERIRNVSYLNPCFHGFCFVCIQEWSERKAECPLCKQYF 79 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73982.17522.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig73982.17522.1 >prot_M-pyrifera_M_contig73982.17522.1 ID=prot_M-pyrifera_M_contig73982.17522.1|Name=mRNA_M-pyrifera_M_contig73982.17522.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=246bp VRKLEDLRVKIHGTVSDDCPICLERMANISIIQPCLHFTCKSCMSKLSGKback to top mRNA from alignment at M-pyrifera_M_contig73982:139..876+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig73982.17522.1 ID=mRNA_M-pyrifera_M_contig73982.17522.1|Name=mRNA_M-pyrifera_M_contig73982.17522.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=738bp|location=Sequence derived from alignment at M-pyrifera_M_contig73982:139..876+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig73982:139..876+ >mRNA_M-pyrifera_M_contig73982.17522.1 ID=mRNA_M-pyrifera_M_contig73982.17522.1|Name=mRNA_M-pyrifera_M_contig73982.17522.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1476bp|location=Sequence derived from alignment at M-pyrifera_M_contig73982:139..876+ (Macrocystis pyrifera P11B4 male)back to top |