mRNA_M-pyrifera_M_contig72905.17314.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72905.17314.1 vs. uniprot
Match: D7KRR2_ARALL (Expressed protein n=1 Tax=Arabidopsis lyrata subsp. lyrata TaxID=81972 RepID=D7KRR2_ARALL) HSP 1 Score: 60.8 bits (146), Expect = 2.240e-11 Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = -1 Query: 34 IHDMIGSDHRKDSLQTNRPIFCMGLTRWLEQRHIFV 141 IH +G DHRKDSL+ N+PI CMGLT+WLEQRHI++ Sbjct: 15 IHGSVGYDHRKDSLKVNQPIPCMGLTQWLEQRHIWL 50
BLAST of mRNA_M-pyrifera_M_contig72905.17314.1 vs. uniprot
Match: A0A4S4EFE9_CAMSI (RPOLD domain-containing protein n=1 Tax=Camellia sinensis var. sinensis TaxID=542762 RepID=A0A4S4EFE9_CAMSI) HSP 1 Score: 55.1 bits (131), Expect = 1.460e-7 Identity = 25/30 (83.33%), Postives = 25/30 (83.33%), Query Frame = -2 Query: 39 SGLIIEKILFKRTGLSSVWGLRGGWNKDTF 128 S LIIEKILFKRT LS VWGL GWNKDTF Sbjct: 648 SDLIIEKILFKRTSLSFVWGLHSGWNKDTF 677
BLAST of mRNA_M-pyrifera_M_contig72905.17314.1 vs. uniprot
Match: M1A200_SOLTU (Uncharacterized protein n=1 Tax=Solanum tuberosum TaxID=4113 RepID=M1A200_SOLTU) HSP 1 Score: 47.0 bits (110), Expect = 7.280e-6 Identity = 24/29 (82.76%), Postives = 25/29 (86.21%), Query Frame = 1 Query: 37 KNVSLFQPPRKPHTEDRPVRLKRIFSMIR 123 K VSLFQ P KP+TEDR VRLKRIFSMIR Sbjct: 10 KCVSLFQSPCKPYTEDRLVRLKRIFSMIR 38 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72905.17314.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72905.17314.1 >prot_M-pyrifera_M_contig72905.17314.1 ID=prot_M-pyrifera_M_contig72905.17314.1|Name=mRNA_M-pyrifera_M_contig72905.17314.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bp MPLSICHILIHNKNVSLFQPPRKPHTEDRPVRLKRIFSMIRPDHVVYback to top mRNA from alignment at M-pyrifera_M_contig72905:35..175+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72905.17314.1 ID=mRNA_M-pyrifera_M_contig72905.17314.1|Name=mRNA_M-pyrifera_M_contig72905.17314.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=141bp|location=Sequence derived from alignment at M-pyrifera_M_contig72905:35..175+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72905:35..175+ >mRNA_M-pyrifera_M_contig72905.17314.1 ID=mRNA_M-pyrifera_M_contig72905.17314.1|Name=mRNA_M-pyrifera_M_contig72905.17314.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=282bp|location=Sequence derived from alignment at M-pyrifera_M_contig72905:35..175+ (Macrocystis pyrifera P11B4 male)back to top |